KEGG   Caenorhabditis briggsae: CBG14484Help
Entry
CBG14484          CDS       T01054                                 

Gene name
Cbr-pdi-2
Definition
C. briggsae CBR-PDI-2 protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CBG14484 (Cbr-pdi-2)
Enzymes [BR:cbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CBG14484 (Cbr-pdi-2)
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CBG14484 (Cbr-pdi-2)
  Exosomal proteins of colorectal cancer cells
   CBG14484 (Cbr-pdi-2)
  Exosomal proteins of bladder cancer cells
   CBG14484 (Cbr-pdi-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 493 aa AA seqDB search
MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAP
EYAKAATQLKEEGSEIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGKPQEYNGGRDHDS
IIAWLKKKTGPVAKPLNDADAVKELQESADVVVIGYFKDTASDDAKTFLEVAAGIDDIPF
GISTEDAVKSEIELKGEGIVLFKKFDDGRVAFDEKLTQDSLKTWIQANRLALVSEFTQET
ASVIFGGEIKSHNLLFVSKESSDFAKLETEFKNAAKQFKGKVLFVYINTDVEENARIMEF
FGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQSYLDGSVKPHLMSEDIPEDW
DKNAVKVLVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKYADHENIVIAK
MDSTLNEVEDVKIQSFPTIKFFPAGSSKVIDYTGDRTIEGFTKFLETNGKDGAGASEEEK
AEEEADEEGHTEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttccggctcgtcggtctgtttttcctcgtcttgggcgcctcggctgccgtcattgaa
gaagaagagaatgtcatcgttcttactaaggacaactttgacgaagtgatcaacggaaac
gaattcatccttgtcgagttctacgccccatggtgcggacactgcaaatcccttgcccca
gaatacgctaaggccgccactcaactcaaggaggaaggatctgagattaagctcggaaag
ctcgatgccaccgtccacggagaagtctcgtctaagttcgaggtccgcggatacccaact
ctcaagcttttccgcaacggaaagccacaagaatacaacggaggacgcgaccacgattct
atcatcgcctggttgaagaagaagaccggaccagtcgccaagccactcaacgacgccgac
gccgttaaggagctccaagagtctgctgatgttgttgttattggatacttcaaggatacc
gcatccgatgacgccaagaccttcctcgaggttgccgccggaatcgacgatattccattc
ggaatctccaccgaagacgctgtcaagtctgagattgagcttaagggagagggaatcgtt
cttttcaagaagttcgatgatggacgtgttgccttcgacgagaagctcacccaagactcc
ctcaagacctggattcaagccaaccgtcttgccctcgtctctgagttcacccaagagact
gcttccgttatcttcggaggagagatcaagtcccacaaccttctcttcgtctccaaggaa
tcatctgacttcgccaagctcgagactgagttcaagaacgccgccaagcaattcaaggga
aaggtcctcttcgtctacatcaacaccgatgttgaggagaacgccagaatcatggaattc
ttcggactcaagaaggacgagctcccagccatccgtcttatctctcttgaggaggacatg
accaagttcaagccagacttcgaggagatcactactgagaacatctccaagttcacccaa
tcttacctcgatggatccgtcaagccacaccttatgtccgaggacattccagaggactgg
gacaagaacgccgtcaaggttctcgttggaaagaacttcgagcaagtcgcccgtgacaac
accaagaacgttctcgtcgagttctacgctccatggtgcggacactgcaagcaattggcc
ccaacctgggacaagctcggagagaagtacgctgaccacgagaacatcgtcatcgccaag
atggactctaccctcaacgaggtcgaagacgtcaagatccaatccttcccaaccatcaag
ttcttcccagctggatcctccaaggtcatcgattacaccggagaccgtaccatcgaagga
ttcaccaagttcctcgagaccaacggaaaggacggagctggagcttccgaggaggagaag
gccgaggaggaggccgatgaggagggacacactgagctctaa

DBGET integrated database retrieval system