KEGG   Caenorhabditis briggsae: CBG14528Help
Entry
CBG14528          CDS       T01054                                 

Gene name
Cbr-glit-1
Definition
C. briggsae CBR-GLIT-1 protein
Organism
cbr  Caenorhabditis briggsae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 724 aa AA seqDB search
MFLGTRYYGIFILPLVICQFIPPPTRPVNLWDPFETTTTPRPSGLNQGLNRDEVVVRLPL
GDIVGKEVHLRNLPWTIHKDPTEELPRDGTHFDPNPLRKNNNITVFTFLGVPYAEPPTSQ
RRFKPPQQLTVFPGKQPFLAFNYAASCAQDVEKRPSPFVDHPYPFTVDEDCLYLNIFSPD
ISKNAPTTYPVIVFFHGGNFQTGSANEWPAHGLASRGMVVVTVNYRLGAFGFMSLGDSDT
GNYGLQDQRLALEFVRDHIATFGGDPQAVTVIGHDAGAASIGLHMQSPKSRHLFRSAATM
SGAEVSYHSYIGKPALAFNNTIKLGRYVGCSETVPQNVWDCLMTKATNDIVYATQTIPIE
YNRYLFMPTVDGNEVPANPLWTLMNAPSGEVSIMSPVPLLIGMNAQDGSEVVLEDRRLGE
FSQFNDVDHEYLKSYALEYCYRHNYSMNREATADAIVSKYTFWPDRAAVWAIKENFIHFA
TDAYYTAPMQLSAHLHSASGSRVFQYVNNYNFSKQHPDLSFIPDWMGVCRDCDLYLMFGY
PFLPDELRPLGLRGINFTDMDRNASRTFSNIVRRFTYYQNPNFLYDGSWVAYEPRRHWYM
NFNYSHEEDWKVPGTIARDYRYQDVAFWNEYIPALVNYMTTTFSPENVAYRREIIVYRWI
TGVNAIIIILLVVLAGAFGYMVFGHKEEEDAVYKGESHQLVDFGIRSVSDGTVSSRTRSP
HSRI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcggcaccagatactatggaatttttattttgccactggtcatttgccagttc
attccgcctccaacacgtccggtaaacttgtgggatcctttcgagacaacaacaacacca
cgaccatcaggattaaaccaagggttaaaccgtgatgaagtggtcgttcgtcttcctctt
ggagacattgttggcaaggaagtacatcttcgcaacctgccctggaccattcacaaagac
ccgacggaagagctgccaagggatggaactcactttgacccgaatcctttgagaaagaat
aacaacatcacagtcttcacgtttctaggggtgccttacgcggagccaccaacgtctcag
aggcgattcaagccgccacaacaattgacagtttttcctgggaaacagccgttcctagct
ttcaactatgctgcttcatgtgctcaggacgttgagaagagacccagcccgttcgtagac
catccatatccattcacagttgacgaagattgtctctacctcaatattttctcccctgac
atatcaaagaatgcgccaacaacctacccagtgattgtgttctttcacggaggcaatttt
caaacaggatccgcaaatgagtggcctgcccatggtttagcgtctcgagggatggtagtc
gtcactgttaactaccgccttggagctttcggattcatgagcttgggagactctgatacc
ggaaactatgggcttcaggatcaacggctggctctggaatttgttcgcgatcacattgca
acgttcggtggagatccacaagctgtcaccgtgatcggccatgatgctggagcagcatcc
attggattacacatgcagtctcccaaatctagacacctcttccgatccgctgcgacaatg
tctggagcagaagtttcctatcactcgtacatcggaaagccagcattggctttcaacaac
actataaagcttggacgttacgttggttgttctgaaaccgtcccacagaatgtgtgggat
tgtctcatgacgaaagccaccaacgacatcgtttacgcaacgcagaccattccaattgaa
tataaccgctacctattcatgccaactgtagatgggaatgaagttcctgcaaatccactc
tggacactgatgaacgctccgagtggagaggtttccatcatgagtccagtgccgctgctg
atcggaatgaacgctcaggatggaagcgaagtggtcttggaggataggcgcttgggagag
tttagtcagtttaacgatgtggaccacgagtaccttaaaagctacgcattggagtattgc
taccgacacaactactcgatgaaccgggaagccactgctgacgccatcgtttcaaagtac
accttctggcctgatagagctgctgtatgggcgatcaaggagaacttcatccattttgca
accgatgcctactacacagctccaatgcagctctcagcacatcttcacagtgcatcagga
tcacgtgtgttccagtatgtgaacaactacaatttcagcaagcagcatccagatctgtcg
tttattcccgattggatgggagtctgcagagattgtgacttgtacctgatgtttggatat
ccattcctacctgacgagttgcgaccgctggggctccgaggtatcaacttcacagacatg
gatcgtaatgctagtcggacgttctccaacatcgtccgtcgtttcacctactatcagaat
ccaaacttcttgtatgatggtagttgggtggcttacgaaccaagacgtcattggtacatg
aacttcaactactcacacgaggaagactggaaggttcctggaaccatcgcgagggactat
cgataccaagacgtcgcattctggaatgagtacatcccggcattggtcaattacatgacc
actacattttctccggagaatgttgcgtatcgacgggagattatcgtctatagatggatc
actggagtcaatgcgatcatcataattctgcttgtagtgttggctggtgcatttggatac
atggtattcggtcacaaggaagaagaggatgccgtctacaagggcgagagccatcaactc
gtcgactttggaatccgttcagtatccgatggaacggtatcttccaggacgagatcccct
cattctagaatc

DBGET integrated database retrieval system