KEGG   Caenorhabditis briggsae: CBG14939Help
Entry
CBG14939          CDS       T01054                                 

Gene name
Cbr-pcaf-1
Definition
C. briggsae CBR-PCAF-1 protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:cbr04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 781 aa AA seqDB search
MKQREILDERRRQLTYFTSCNAGTCQCRGFRPVLSNEEETVERRATRAERENDYAPMTRD
LESLASEEIIECRTCGHSISFHAEPIKTLSEEEIDTYTDRIADLQTCCSELSEIDPTNES
LQTLYITMQMLLKSLRTLTPIEVPFIGKPNFEPDSFSPFILVKKFIASRPVDNAEKHRLA
EIGTLFLTEMNHWRLESFENLASNLSEQLEQGRYRMMFTRLDYYVNMPSKYLTFKQYQTV
DIFGEKFALTFCDYLINALNSEGYSPFGISESDLEESSEDLTTFATELKSWIELQNFTDD
SYPSSSQRRKDSSVSMEDLQLTYVKRKKPTDHSESASSRESTTSPVNDESEEPLKKKKDR
SSSQPSTANSTKKSPETDESMAVVRSLIRAIKLESDMDAMEPKTKADFEELNKEVSRGLG
ALRDEESGLIEFRVIGNDLDPFQDHEQLAQLVELQNLFGAQLPKMPKDYVTRLIFDSRHL
NMVILKRDVGVIGGICFRPFTNRGFVEIVFCAITAQEQVKGYGTHLMNHCKDYMIKNKIY
HMLTFADEFAIGYFTKQGFSDKLEIKPTVYHGWIKEYEGATLMGCHLHPQISYIKFPDFS
KGIQALHIGYKMENGAECRGRVFGGLEHIFRESASGFIELRKIPGTDSLKMNKKTCYQLD
ELDDTLDTRIVSILKKLTADKNAWPFLKPVDKHEVPDYYAYIKHPIDFKTIQEKFRRKYY
AHQHLFIADLTRMFQNCYSFNGIDTIYYKLAYKLNEVALKLLKSAFPESSLYPELPERPS
N
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgagaaattttggacgagcgacgaaggcaactgacatatttcacatcttgt
aatgctggaacatgtcaatgtcgcgggttccgaccagtcttgagtaatgaagaggagaca
gttgaacgaagagctacaagagctgagcgcgaaaatgactacgcaccaatgaccagagat
ttggagtctttagcatcagaagaaattatagaatgtagaacatgtggacattcgatttca
ttccatgcggaaccaataaaaacgttgtcagaagaagagattgacacttatacagataga
atagctgatcttcagacatgttgctcagaactcagtgaaatcgatcctactaacgaatca
cttcagacgttatatatcactatgcaaatgcttctgaaatctctgcgcacgttgacaccc
atagaagttcctttcattgggaagcctaacttcgagcccgactcatttagcccgttcatt
cttgtcaaaaaattcattgcttctcggcctgtggacaatgcagaaaaacatagacttgcc
gaaatcggaactttattcctcacggaaatgaaccattggcgcctggaaagtttcgaaaac
ttagctagcaacttgagcgaacaactggagcagggaagatacaggatgatgttcactcgg
ttggactactacgtcaatatgccatcaaaatacctgacattcaagcagtaccagactgtg
gacatcttcggtgaaaaattcgcactcactttctgcgactatttgatcaacgcactgaat
tcagaaggatactctccgttcggtatctcagaaagtgatttggaagaaagctcagaggac
ttgacgacgtttgcgaccgagttgaaatcctggatagaactgcaaaattttaccgatgac
tcttacccttcttcgtctcaacgccgaaaggattcgtccgtctccatggaagatttacag
ttgacgtacgtgaaacgtaagaagcccaccgatcattcagaaagtgcgtcttctcgagag
tccacgacgtctccggtaaacgacgaatcggaggagcctctgaaaaagaaaaaagatcgg
tcatcttcgcagccatcaacggcgaactcaacaaagaaatcacccgaaaccgacgaatcg
atggcagttgtacgatcattaatccgtgcgataaagctggagagtgacatggatgctatg
gagccgaaaacaaaagccgactttgaagaattgaataaagaagtatcgcgtggattgggt
gcacttcgtgatgaggagagtgggctcatcgagttcagagtaattggaaatgacttggac
ccattccaagaccacgagcaactcgctcaactcgtagaacttcagaatttgttcggagca
cagcttccgaagatgccaaaggattatgtcacacgtcttatctttgattctcgtcacttg
aatatggtaattttgaaacgagatgtcggagtgatcggtggaatttgcttccgaccattc
acaaatcgaggatttgtagaaatagttttctgtgccataacagcacaagagcaagtgaaa
gggtacggtacccatctgatgaatcattgcaaggactacatgatcaaaaacaaaatttat
cacatgctaaccttcgcagatgagtttgccatcggatacttcacaaaacaaggattttct
gataaacttgaaatcaagcctactgtatatcatggttggattaaagaatacgaaggtgct
accttgatgggttgccatttgcatccacaaatttcctacatcaagttcccagatttttca
aagggcattcaagctctgcacattggatacaagatggagaacggtgcagagtgtagaggt
cgagtattcggaggactcgagcatatattccgagagagtgcttcaggtttcattgaacta
cggaaaattcccggaacagactctctgaaaatgaataagaagacttgctatcaactcgac
gagctggacgatacactcgacacacggatcgtgtcgatcttgaaaaaactgacagctgat
aaaaatgcatggccttttttgaagcctgtagataaacatgaagttcccgattactacgcc
tacataaagcaccctatcgacttcaaaactattcaggaaaaattcagaaggaaatattat
gctcatcaacacctgttcatagctgatctgacaagaatgttccaaaactgctactccttc
aacggcatcgacacaatttactataaactggcatataaattaaacgaggtagccttgaag
ctactaaaatcggcgtttccagaaagttcactctatccagagcttcctgagcgcccatct
aattaa

DBGET integrated database retrieval system