KEGG   Caenorhabditis briggsae: CBG15416Help
Entry
CBG15416          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG15416
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cbr  Caenorhabditis briggsae
Pathway
Longevity regulating pathway - multiple species
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    CBG15416
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CBG15416
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CBG15416
Chromosome [BR:cbr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CBG15416
   HDAC complexes
    Sin3A-HDAC complex
     CBG15416
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CBG15416
  Chromatin remodeling factors
   NuRD complex
    CBG15416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 470 aa AA seqDB search
MSYNVREHSSKKIAYYYDSNIGNFHFGPEHPMKPNRIRLAHQLVTAYGLYRHMDIFRPFP
ATRKDMQEFHPEDYTYFLSVAEPQRVEWLAKDMKKYNIGEDCPIISDLFQYNQTTCGGTL
AAATKLNKQKADIVINWMGGSSHAKYAEANGFCFTNDVVLGILKLLDFHPRVLYVDIDVL
HGDGVEEAFYCTDRVMTVSFHQYGKGVFPGTGNVQSIGAEEGTGYSVNVPLKEGITDKVY
QSIFKPIITKVMDRFDPSVIVLQCGPDSLSGDKIGRFNLTLDGHGECVSFLRSFNLPLML
LGGGGFNSDNVAKCWANETAIACGQNLPVRPPGNDYKKYFRSSFRLPVKPSNMANHNRPK
ELAAIQREIFANLNSLPAVPSVQMQPIQEEILAPLPEVSQVLEMANPDERLPPQVMDSVV
AHEGEFYDFENGSGANRGVVQYADMTPPDDWFLDDFFQDLQTIEMRSEMV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaatgtgcgggagcactcttctaaaaaaatcgcgtactactatgacagtaac
attggaaattttcactttggcccagaacatccaatgaaaccaaatcgtattcgattggcc
catcaactagtcacagcttatgggttgtatcggcatatggacatttttaggccatttcca
gcaacacgtaaagacatgcaagagttccatccagaagactatacatatttcctatcggta
gcagagccacaacgagttgaatggcttgcgaaagacatgaaaaaatataacattggtgaa
gactgtccgatcatctcagatctcttccaatataatcagactacatgtgggggtacactt
gcagcagcaacaaaactcaacaagcaaaaagctgacattgtaatcaactggatgggaggt
tcaagtcatgcaaaatatgcagaagcaaatggattttgctttaccaatgacgttgttctc
ggaattctcaaattacttgatttccatcctcgtgttctctacgtcgacattgatgttctc
catggcgatggtgtagaagaagcattctactgcactgatcgtgtaatgacggtttcattt
catcaatatggaaaaggagtttttccgggaactggaaatgtgcaatcaataggagctgaa
gaaggaacaggatactctgtaaacgttccacttaaagaagggatcaccgacaaagtttat
caaagcattttcaaaccaattatcaccaaagtgatggatcgattcgatccaagtgtgatc
gttcttcaatgcggaccagattcactctcaggcgataaaattggaaggttcaaccttact
ctggatgggcatggagaatgtgtcagcttcctaagatcattcaacctcccattaatgctt
ctcggtggtggtggcttcaattctgataatgttgctaaatgctgggcaaatgaaacagcc
attgcttgcggccaaaatctcccggttagaccaccagggaacgactacaagaaatacttc
cggtccagtttccgtcttccagtcaagccttcaaatatggcgaatcacaacagaccaaaa
gagttggctgcaattcaacgggagatatttgcaaacttgaacagtttaccagcagttcca
agtgttcaaatgcaaccgattcaagaggaaattttagcaccgttgccagaagtgtcacaa
gttcttgaaatggccaacccggatgagagactcccaccacaagtaatggatagtgttgtt
gcacacgaaggagaattctacgattttgaaaatggttctggagcaaatcgcggagtcgtt
cagtacgcggacatgacacctccagacgactggtttttggatgattttttccaagacttg
caaacgattgaaatgagatctgaaatggtttaa

DBGET integrated database retrieval system