KEGG   Caenorhabditis briggsae: CBG15416Help
Entry
CBG15416          CDS       T01054                                 

Definition
Hypothetical protein CBG15416
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cbr  Caenorhabditis briggsae
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:cbr04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 470 aa AA seqDB search
MSYNVREHSSKKIAYYYDSNIGNFHFGPEHPMKPNRIRLAHQLVTAYGLYRHMDIFRPFP
ATRKDMQEFHPEDYTYFLSVAEPQRVEWLAKDMKKYNIGEDCPIISDLFQYNQTTCGGTL
AAATKLNKQKADIVINWMGGSSHAKYAEANGFCFTNDVVLGILKLLDFHPRVLYVDIDVL
HGDGVEEAFYCTDRVMTVSFHQYGKGVFPGTGNVQSIGAEEGTGYSVNVPLKEGITDKVY
QSIFKPIITKVMDRFDPSVIVLQCGPDSLSGDKIGRFNLTLDGHGECVSFLRSFNLPLML
LGGGGFNSDNVAKCWANETAIACGQNLPVRPPGNDYKKYFRSSFRLPVKPSNMANHNRPK
ELAAIQREIFANLNSLPAVPSVQMQPIQEEILAPLPEVSQVLEMANPDERLPPQVMDSVV
AHEGEFYDFENGSGANRGVVQYADMTPPDDWFLDDFFQDLQTIEMRSEMV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaatgtgcgggagcactcttctaaaaaaatcgcgtactactatgacagtaac
attggaaattttcactttggcccagaacatccaatgaaaccaaatcgtattcgattggcc
catcaactagtcacagcttatgggttgtatcggcatatggacatttttaggccatttcca
gcaacacgtaaagacatgcaagagttccatccagaagactatacatatttcctatcggta
gcagagccacaacgagttgaatggcttgcgaaagacatgaaaaaatataacattggtgaa
gactgtccgatcatctcagatctcttccaatataatcagactacatgtgggggtacactt
gcagcagcaacaaaactcaacaagcaaaaagctgacattgtaatcaactggatgggaggt
tcaagtcatgcaaaatatgcagaagcaaatggattttgctttaccaatgacgttgttctc
ggaattctcaaattacttgatttccatcctcgtgttctctacgtcgacattgatgttctc
catggcgatggtgtagaagaagcattctactgcactgatcgtgtaatgacggtttcattt
catcaatatggaaaaggagtttttccgggaactggaaatgtgcaatcaataggagctgaa
gaaggaacaggatactctgtaaacgttccacttaaagaagggatcaccgacaaagtttat
caaagcattttcaaaccaattatcaccaaagtgatggatcgattcgatccaagtgtgatc
gttcttcaatgcggaccagattcactctcaggcgataaaattggaaggttcaaccttact
ctggatgggcatggagaatgtgtcagcttcctaagatcattcaacctcccattaatgctt
ctcggtggtggtggcttcaattctgataatgttgctaaatgctgggcaaatgaaacagcc
attgcttgcggccaaaatctcccggttagaccaccagggaacgactacaagaaatacttc
cggtccagtttccgtcttccagtcaagccttcaaatatggcgaatcacaacagaccaaaa
gagttggctgcaattcaacgggagatatttgcaaacttgaacagtttaccagcagttcca
agtgttcaaatgcaaccgattcaagaggaaattttagcaccgttgccagaagtgtcacaa
gttcttgaaatggccaacccggatgagagactcccaccacaagtaatggatagtgttgtt
gcacacgaaggagaattctacgattttgaaaatggttctggagcaaatcgcggagtcgtt
cagtacgcggacatgacacctccagacgactggtttttggatgattttttccaagacttg
caaacgattgaaatgagatctgaaatggtttaa

DBGET integrated database retrieval system