KEGG   Caenorhabditis briggsae: CBG15441Help
Entry
CBG15441          CDS       T01054                                 

Definition
Hypothetical protein CBG15441
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbr  Caenorhabditis briggsae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG15441
Enzymes [BR:cbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CBG15441
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C44
   CBG15441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 567 aa AA seqDB search
MCGVFAICQQTCQKGQKVDIDEARKLSRRQHHRGPDFNGFYQDKKTGDILVHERLAIMDL
GCVQPIQGTRPTRQVIHNGEIYNHQALRDTELKQFKLKTTCDSEVIIFLYERYRDGHICN
MLDGVFAFALCYDGDFLAARDPVGVKQFYYGIDANGRYFFSNEMKCLEDSCGDIKIESFP
PGHYYTPKTGFVRYFNPQWFDYRNAIQALDLKLLQKTMIAAVHKRLMSDAPIGVLLSGGL
DSSLVSSIASREMKRRGMTVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIQEGIK
NLRKLIWHLESYDVTSIRASTPMYFLSEEIRKKGIKVVLSGEGADEIFGGYLYFHNAPSD
EEFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFMEAAITLDPAFKRPQKLE
DGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYNWIDSLMQHCASKITDKEFA
QASKLFPHNTPHSKEAFYMRKIFHELFPSDQAALTVRKWIPKWQKNQDPSGRASLVHESS
YHNLGEDNCNGKSAITQQRIEQCRPQA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtctttgctatctgccaacaaacttgccaaaaagggcaaaaggtcgacatc
gatgaagctcgaaagctgtcgagaagacaacaccatcgtggaccggacttcaacggattc
taccaggacaagaagaccggagacatcctcgtccatgagcgtctggccatcatggatcta
ggatgtgttcagcctatacaaggaacaagaccaacacgacaggtgattcacaacggtgaa
atctacaaccatcaagctcttcgtgacactgagctcaagcaattcaagctcaagactact
tgtgactcggaagtcattatcttcttgtatgagagataccgtgatggtcacatctgcaac
atgctcgatggagtgttcgcttttgctctctgctatgacggagacttcctcgcggctcgt
gacccagttggagtcaagcaattctactatggaattgatgccaacggaagatacttcttc
agtaacgagatgaagtgcttggaagacagctgtggagatatcaagatcgagtcctttcca
ccaggacactactacactccaaagaccggatttgttcgttacttcaacccacagtggttc
gactacagaaacgccattcaagcattggacctcaaacttctccagaagactatgattgct
gctgtccacaagcgtttgatgtctgacgccccaatcggagtgttgctttccggaggtctc
gactccagcttggtcagctctattgcctcgagagaaatgaagagaagagggatgaccgtt
cactctttctccatcggtgtcgatcacaactctccagatgtggtggctgctagaaaggtg
gccaagttcatcggaaccactcatcatgaattctacttcagcattcaggaaggaatcaag
aacctccgcaagctgatctggcacctcgagtcttacgatgtaacctcgatccgtgcttct
actccaatgtacttcctttctgaagagatcagaaagaagggaatcaaggttgttctctct
ggagaaggagctgacgagatcttcggtggatacctctacttccacaatgccccatccgac
gaggagttccaaaaagaaaccatcgaccgtgttcttcatctctacacttctgattgcctc
cgtgctgacaagtcttccatggctcactctgtcgaagtccgtgtgccattccttgacaag
gccttcatggaagctgccatcaccttggatccagcattcaagcgtccacagaagctcgag
gacggaagaaactgcgagaagtttgttcttcgctctgccttcaacactgatcaataccca
tatcttccggatgagatcctctggagacaaaaggaacaattctccgacggagttggatac
aactggatcgactctcttatgcaacactgtgcctctaagattaccgacaaggaattcgcc
caggcttccaagttgttcccacacaacactcctcacagcaaggaggcattctacatgaga
aaaattttccatgagctcttcccatcggaccaagctgctctgactgtcagaaaatggatt
ccaaagtggcaaaagaaccaagacccatcaggaagagcttcccttgttcacgaaagttcc
tatcacaacttaggcgaggacaactgcaacggaaagtccgccatcacccagcaacgtatt
gagcagtgcagaccacaagcataa

DBGET integrated database retrieval system