KEGG   Caenorhabditis briggsae: CBG16145Help
Entry
CBG16145          CDS       T01054                                 

Definition
Hypothetical protein CBG16145
Orthology
K04437  
filamin
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 428 aa AA seqDB search
MSETVGYESIRQKIQSRFYHTVRIYCQGSELPASPIQLQVHTQEETRSTSRAASRAHPEN
RNPGATTSTSTVRTTVSPVDISHKSFAQRRLHIIKQLEAQHVNHIAQTKSHHQPQQQQQH
HQPQPHQQSPSIVQVVLPTPPPPPTSAQNSSHIPPAPPIPAVLEASAYREMPLTRSPDVG
LVSFSGLSEPCSVGSIVEVVINAHGDAVSGSVYVEAVSPSGTVHPCTVRHQNNTYMATFT
PQEVGLWRIGILYDGEHIRGSPFACQVFDSGLVNVYGLDVGLVGQELRFSVNTSQAGHGN
LSVTVLRHGREIPLNIEEQGNSKNHQVSFIPDGAGQYKIHVLFNRMEIKGSPFVLDIADA
SSVSTYGENLRSASVGKTASFMVHAVGADAKDISAYVTAPSGGKFPAKIVTLDDVTFKIE
WTPNEPGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaactgtaggctatgagagtatccgtcaaaaaattcaatccagattctatcat
actgttcgtatctactgtcagggctccgaactaccagcgagccctatccaattacaagtt
cacacccaggaagagacacggagcacttcgagagcagcgtctcgtgctcatccggaaaat
agaaatcctggagcaacaacatcaacgtcgactgtgagaactacagtatcgccagtggac
atatcacacaaatcattcgcgcaacgacgtctccatattatcaaacagcttgaagcgcaa
cacgtcaatcatattgcgcagacaaaatcacatcatcaacctcagcaacaacaacaacat
catcagccacaacctcaccagcagtcaccgtcgatagttcaagttgtgctgcctacacca
ccgccaccgcctacttcagcacaaaatagctctcatattccaccagcaccaccaatccca
gctgttctggaagcatctgcatacagagaaatgccgttgacaagatcgcccgatgttgga
ctcgtttcgttctcaggactttcagagccatgctcagttgggtccattgtggaagttgtg
atcaacgctcatggagacgcagtgtctggatcagtttacgttgaagctgtgtcaccatct
ggaacagttcatccatgcactgtccgacatcagaacaacacctacatggccacattcacc
cctcaggaagtcggactatggagaatcggcatcctgtacgacggcgaacacattcgagga
agcccgttcgcatgccaggtgttcgattctggtcttgttaatgtatatggtcttgatgtc
ggattagttggacaagaattgaggttttctgtaaacacttcccaagcaggacatggaaat
ttgagtgttacggttctacgtcacggaagagaaattccgttgaacatcgaagaacaagga
aattcaaaaaaccaccaagtatcgttcattcccgacggagctggtcaatacaaaatccac
gtgttgttcaatagaatggagattaaaggctccccattcgttttggacattgccgacgct
tcatcagtgtccacctatggtgaaaatttgagatcagcatcagttggaaaaaccgcatcc
ttcatggtccatgctgttggagcagatgccaaagatatcagcgcttatgtcacagcacca
tcgggtggcaagttcccagccaaaatcgtcacattggacgatgtcacgtttaaaatcgaa
tggacgccaaatgaaccaggtttgtag

DBGET integrated database retrieval system