KEGG   Caenorhabditis briggsae: CBG16146Help
Entry
CBG16146          CDS       T01054                                 

Definition
Hypothetical protein CBG16146
Orthology
K04437  
filamin
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG16146
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG16146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 365 aa AA seqDB search
MGKQGEEARQKWIDIQLHTFTNWINEQLQGNVIQDLTQDLSDGVNLIRLVEILQGRRYYG
KVYDQEPTEIQKLMNVQMALDALREDGVKTVNIGSHDIVDGNEKLILGLIWCLVQRYQIA
CKTKIPPKKLVMAWIQSALPELKLTNFRTNWNDGIALSALLEYCQPGLCPEWRNLDPSAA
RENCHRAILLAERYLEVPGIISSDHLSSPHLDELSCLTYLSYFITKGAPGYRATLKKVSL
LLPDCNVEDLEHSWSDGFLLAHLVEACGGSVPEIERMRFENLNDFVENVAVVLDAAADIG
VGSLIGADDIADPQGEHLVNFFFGNCYQLFPKKNFFSKSPIFSDKTVNFKLQYLGSHEMY
QKSVN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaaggagaagaggctcgtcagaaatggatcgatattcaacttcacacattt
acaaactggataaatgagcagctacaaggaaatgtgatacaagacttgacccaagattta
tcggatggtgtgaatctcatcagactcgtagaaatcctccaggggcgaaggtactatgga
aaggtgtacgatcaagaaccaacggaaattcaaaaactaatgaatgtgcaaatggcactg
gatgctcttcgagaagatggtgtgaagacagtaaacattggaagtcatgatattgtagat
ggaaatgagaaattgatattgggcttgatttggtgtctggttcaaaggtatcaaatcgcg
tgtaaaacaaaaattcctccaaagaaattggttatggcttggatacagagcgctcttcct
gaactgaaactcacgaatttccgaacaaactggaacgatggaattgctctaagcgctctt
cttgaatactgtcagcctgggttgtgcccggaatggaggaatttagatccgtcagcagct
cgagagaattgtcaccgagctatattacttgctgaacgatacttagaagtccctggaatc
atttcttctgatcacttgtcatctccacatctagatgaactctcctgcttgacgtatttg
tcatatttcataactaaaggtgctccagggtacagagcaactttgaaaaaagtgtcattg
cttctgccagactgcaacgtcgaagatctcgagcattcctggagtgatggtttccttctc
gcccatctagtggaagcgtgtggtggctcggttcccgagatcgaacgaatgcgatttgag
aatttgaacgattttgttgaaaatgtggcagttgtgctcgacgcagctgcagacattggt
gtcggatcgctcatcggcgcagatgacattgccgatcctcaaggagaacatctggtaaat
tttttttttggaaattgttatcaattatttccaaaaaaaaattttttttcgaaatcacct
attttttctgacaaaaccgtcaatttcaagctccaatatctcggttcgcatgagatgtat
caaaaaagtgtcaactga

DBGET integrated database retrieval system