KEGG   Caenorhabditis briggsae: CBG16249Help
Entry
CBG16249          CDS       T01054                                 

Gene name
Cbr-aak-2
Definition
C. briggsae CBR-AAK-2 protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cbr04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cbr04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:cbr04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 562 aa AA seqDB search
MSSPGGETSLTKKPELVAQIKIGHYILKETLGVGTFGKVKVGIHEGTSYKVAVKILNRQK
IKSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRL
KTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGDFLR
TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKSGVF
PTPEFLERPIVNLLHHMLCVDPMKRATIKDVIAHEWFQKDLPNYLFPPINESEASIVDIE
AVREVTERYHVAEEEVTSALLGDDPHHHLSIAYNLIVDNKRIADETAKLSIEEFYQVTPN
KGPGPVHRHPERIAASVSSKITPTLDNTESTGSARNKRAKWHLGIRSQSRPEDIMFEVFR
AMKQLDMEWKVLNPYHVIVRRKPDAPAADPPKMSLQLYQVDQRSYLLDFKSLADEESGSA
SASSSRHASMSMPQKPASIRGTRTSSMPQAMSMEASIEKMEVHDFSDMSCDVTPPPSPGG
AKLSQTMQFFEICAALIGTLAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaccgggtggcgagacctcgttgactaagaagccggagctcgttgctcaaatc
aaaattggacattatattctgaaagagacgcttggagttggtaccttcggaaaggttaaa
gttggaatccatgaaggaacttcgtacaaagtggcggtgaagattctgaatcgtcagaag
atcaaatcactcgacgtcgtgggaaagatccgtcgtgagatccagaatctctcacttttc
cgtcatcctcacatcatccgcctctaccaagtcatcagcactccatcggacatcttcatg
attatggagcacgtttctggaggagaactcttcgactacattgtcaagcacggacgtctg
aagactgccgaagcccgccgatttttccaacaaatcatttctggagtggattattgtcat
cgtcacatggttgttcatcgcgatctgaaaccagagaatttactactcgatgaacaaaac
aacgtgaagattgccgactttggattgtcaaacattatgaccgacggagattttctacgt
accagctgcggatcacctaattatgctgcaccagaagtcatcagtggaaaactctacgct
ggtcccgaagtcgatgtctggtcatgcggagtgatcctctatgcacttctctgtggtact
cttccattcgacgacgaacatgtaccaagtctcttcagaaagatcaaatccggagtcttc
cctacaccagaattcttggaacgaccaatcgtcaacttgcttcatcacatgttgtgtgtc
gatccaatgaagagagctacgatcaaggacgtgatcgcccacgaatggttccaaaaggat
ctaccaaattatcttttcccaccaatcaacgagagcgaagcttccatcgttgatattgag
gccgttcgtgaagtgactgagcgctaccatgttgccgaggaagaagtgacatcggctctt
ctgggtgacgaccctcaccatcatctctccattgcctacaatttgattgtggacaacaag
cgtattgctgatgagacagctaagctgtcgatcgaggagttttatcaagttactccaaat
aagggaccaggaccagttcatcgtcatcctgagcgtattgctgcgtcggtcagcagcaag
atcacaccaacgctcgacaacactgaatcgactggatcagcacgtaacaagcgtgccaag
tggcatcttggcattcgctctcaaagtcgtccagaggacattatgttcgaagtgttccgt
gctatgaagcaacttgatatggaatggaaggttttgaatccataccacgtcatcgtgcga
cgcaagccggatgccccagctgccgatccaccaaagatgtcacttcaactctaccaagtt
gaccagaggagctatcttctcgatttcaagagcttggcagatgaggagtctggatcagca
agtgcatcgtcgtctcgtcacgcttcaatgtcaatgccacagaaaccggctagcattcgt
ggaacacggacgtcaagcatgccacaagcgatgagcatggaggcgagtattgagaaaatg
gaagtgcatgacttttcggatatgtcgtgcgatgtgacaccaccaccatcgccaggagga
gccaagctgtcacagacaatgcaattttttgagatttgcgctgctctaattggaactttg
gctcgttaa

DBGET integrated database retrieval system