KEGG   Caenorhabditis briggsae: CBG16249Help
Entry
CBG16249          CDS       T01054                                 

Gene name
Cbr-aak-2
Definition
C. briggsae CBR-AAK-2 protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CBG16249 (Cbr-aak-2)
   04150 mTOR signaling pathway
    CBG16249 (Cbr-aak-2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    CBG16249 (Cbr-aak-2)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CBG16249 (Cbr-aak-2)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   CBG16249 (Cbr-aak-2)
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CBG16249 (Cbr-aak-2)
  Mitophagy factors
   Other mitophagy factors
    CBG16249 (Cbr-aak-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 562 aa AA seqDB search
MSSPGGETSLTKKPELVAQIKIGHYILKETLGVGTFGKVKVGIHEGTSYKVAVKILNRQK
IKSLDVVGKIRREIQNLSLFRHPHIIRLYQVISTPSDIFMIMEHVSGGELFDYIVKHGRL
KTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGDFLR
TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKSGVF
PTPEFLERPIVNLLHHMLCVDPMKRATIKDVIAHEWFQKDLPNYLFPPINESEASIVDIE
AVREVTERYHVAEEEVTSALLGDDPHHHLSIAYNLIVDNKRIADETAKLSIEEFYQVTPN
KGPGPVHRHPERIAASVSSKITPTLDNTESTGSARNKRAKWHLGIRSQSRPEDIMFEVFR
AMKQLDMEWKVLNPYHVIVRRKPDAPAADPPKMSLQLYQVDQRSYLLDFKSLADEESGSA
SASSSRHASMSMPQKPASIRGTRTSSMPQAMSMEASIEKMEVHDFSDMSCDVTPPPSPGG
AKLSQTMQFFEICAALIGTLAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaccgggtggcgagacctcgttgactaagaagccggagctcgttgctcaaatc
aaaattggacattatattctgaaagagacgcttggagttggtaccttcggaaaggttaaa
gttggaatccatgaaggaacttcgtacaaagtggcggtgaagattctgaatcgtcagaag
atcaaatcactcgacgtcgtgggaaagatccgtcgtgagatccagaatctctcacttttc
cgtcatcctcacatcatccgcctctaccaagtcatcagcactccatcggacatcttcatg
attatggagcacgtttctggaggagaactcttcgactacattgtcaagcacggacgtctg
aagactgccgaagcccgccgatttttccaacaaatcatttctggagtggattattgtcat
cgtcacatggttgttcatcgcgatctgaaaccagagaatttactactcgatgaacaaaac
aacgtgaagattgccgactttggattgtcaaacattatgaccgacggagattttctacgt
accagctgcggatcacctaattatgctgcaccagaagtcatcagtggaaaactctacgct
ggtcccgaagtcgatgtctggtcatgcggagtgatcctctatgcacttctctgtggtact
cttccattcgacgacgaacatgtaccaagtctcttcagaaagatcaaatccggagtcttc
cctacaccagaattcttggaacgaccaatcgtcaacttgcttcatcacatgttgtgtgtc
gatccaatgaagagagctacgatcaaggacgtgatcgcccacgaatggttccaaaaggat
ctaccaaattatcttttcccaccaatcaacgagagcgaagcttccatcgttgatattgag
gccgttcgtgaagtgactgagcgctaccatgttgccgaggaagaagtgacatcggctctt
ctgggtgacgaccctcaccatcatctctccattgcctacaatttgattgtggacaacaag
cgtattgctgatgagacagctaagctgtcgatcgaggagttttatcaagttactccaaat
aagggaccaggaccagttcatcgtcatcctgagcgtattgctgcgtcggtcagcagcaag
atcacaccaacgctcgacaacactgaatcgactggatcagcacgtaacaagcgtgccaag
tggcatcttggcattcgctctcaaagtcgtccagaggacattatgttcgaagtgttccgt
gctatgaagcaacttgatatggaatggaaggttttgaatccataccacgtcatcgtgcga
cgcaagccggatgccccagctgccgatccaccaaagatgtcacttcaactctaccaagtt
gaccagaggagctatcttctcgatttcaagagcttggcagatgaggagtctggatcagca
agtgcatcgtcgtctcgtcacgcttcaatgtcaatgccacagaaaccggctagcattcgt
ggaacacggacgtcaagcatgccacaagcgatgagcatggaggcgagtattgagaaaatg
gaagtgcatgacttttcggatatgtcgtgcgatgtgacaccaccaccatcgccaggagga
gccaagctgtcacagacaatgcaattttttgagatttgcgctgctctaattggaactttg
gctcgttaa

DBGET integrated database retrieval system