KEGG   Caenorhabditis briggsae: CBG16328Help
Entry
CBG16328          CDS       T01054                                 

Gene name
Cbr-hda-4
Definition
C. briggsae CBR-HDA-4 protein
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CBG16328 (Cbr-hda-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 892 aa AA seqDB search
MAFFSSSSSSFPVVFARMEEASSSTGSTGGAMAGIPVIPSTSAALLANTNLEPERIAVLQ
TQLQEYRQKQMDLIGHFQRAQQELSVQHMHNLYTALQQQQQLQSLQERSGINPMLISQTS
EDATSGPAAPLSLANSLTNLLSSSNGNLSNLSVPQTPTKEHHPTLPPQQPSAPTSSRKSD
LPRTNSTTISQLTKDRLKNMIANRSKGESNSQSNLMSNVNGHDNSRRLKNSNSQMNVSSP
HFEPYRLPTSLANAHNLQQASEFQLRKVNSEPNLKMKIRAKLLSKGNSPVQHVQQTNNSQ
FSFTHPQLKRSDSETSNMPIDMLPSGSHSNIPHLMLPSPSLPNLAAATGAFQNLNLPIGQ
DLTAFMAVANLSPFLSLPSLLNKKLELGGMTDEGDRNGFSSSASNSSLASNASLGSHQYQ
SLLKQQIRDLVLRRKSLVREDPEGEGMAESYNGLFSHAKLQQLTALAMESGFNPKLEPTF
STGLGYDPLMARHECVCSNNSNHVENGERIQRIWSKLTEEGHVAKCERITAKKASLEQLQ
MVHSQTYTTFFAVSPTACLKIDANALPLKRFLQLPCGGIGIDSDTYFNDASTQIAARLAA
GTLIELSSQVAEGRLKNGFACIRPPGHHAEAEQALGFCFFNNVAVTAKVLQAKYPVQCAK
IAIIDWDVHHGNGTQLSFDDDPNVLYMSLHRHDNGNFFPGTGSVTEIGKGAGKGFSVNIP
FSGGVMKDAEYLAAWRTVVEPVLASFCPDFILVSAGFDACHGHVNALGGYEITPEMFGYM
TKCLLSYANGKVVLALEGGYNLDSISAAAEQCVQALIGESDDAGRLCTDSLENLPNQSAL
ETLQKVIAIHKGFWPALHGQEAAINTTEMQWRNVKLQVQMQQQQQLQQQLQQ
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttctcctcatcatcatcttcattcccggtcgtttttgcacgtatggaagaa
gccagctcctcaacggggagcactggcggagcaatggctggaattccggttataccatcg
acatcggccgcgcttttagcgaacacaaatttggaaccggaacggatcgcggtgctgcag
acacagcttcaggagtatcggcagaagcaaatggacctcataggtcactttcaacgcgct
cagcaggagctgagcgttcaacacatgcacaatctctacacggcactacaacaacaacag
cagctgcagagtttgcaagagagaagcggaatcaatccaatgttaatcagtcagacgtcg
gaggatgcaacctctggaccagcggcacctctctcacttgcaaattctctcaccaaccta
ctctcttcctcaaatggcaatctctctaatctatccgtaccacagacaccaacaaaagag
caccatccgacactgccgccacagcagccgtcggcgccaacttcaagccgaaaatctgac
ctcccacggacaaactccacaacgatatcgcagctcactaaagaccgcttgaaaaacatg
attgccaacaggagcaagggagagagcaatagtcaaagcaatctgatgtctaatgtaaat
ggacatgacaactcaaggaggctcaaaaactccaactcacagatgaacgtgtcttcacca
cactttgagccataccggttgccaacaagtctggcaaacgctcacaacttacaacaggcc
agcgagttccagctcaggaaggtgaattcggaaccaaacttgaagatgaaaatcagagcg
aaactattgtctaaaggaaatagcccagttcagcatgtacagcagacgaacaactcgcag
tttagtttcacacatccacaattgaaaagaagtgatagcgagacgtctaatatgcctatc
gacatgctgccgtctggctcacatagcaatattccacatcttatgcttccatcaccatcg
ctacccaacctcgctgccgctacaggagcgttccagaatttgaacttgccgattggacaa
gatctcactgctttcatggccgtcgccaacctcagcccattcctcagtcttccaagttta
ctgaataaaaagctggaactgggtgggatgacggatgaaggagaccggaacgggttttca
agctccgcctccaactcatctctcgcttctaatgcaagcctaggatctcaccagtatcag
tctcttctgaaacaacaaatccgtgatctggtccttaggcggaaaagtctcgtgcgtgaa
gacccagaaggagaaggcatggcagaatcttacaacggtctcttctctcatgctaaactt
caacaactcacagcgcttgccatggagtccggtttcaatccaaagctagaaccaactttt
tcaactggtcttggatacgatccactaatggctcgacacgagtgtgtctgcagcaacaat
agcaatcacgtggagaatggagagaggattcaacgaatctggtcgaagcttactgaagaa
ggacatgttgccaaatgcgagagaatcacggcgaaaaaagcttctttggagcaacttcag
atggttcactctcaaacctacacgactttcttcgcagtttctcctaccgcttgcctgaaa
attgatgccaacgcgttgccgttgaaacgattccttcagcttccatgtggaggcatcggc
attgactcggacacctattttaatgacgccagcactcagattgctgctcgtttagccgct
ggaacattgattgaactgtcttcacaggttgccgagggacgtttaaagaacggattcgct
tgcatccgaccgccaggtcaccatgctgaagctgaacaagcactaggattctgtttcttt
aacaacgtggctgtcactgctaaggttcttcaagccaagtatccggttcaatgcgccaag
atcgctatcattgattgggacgtccaccacggaaatggaacgcagttgagttttgacgac
gacccgaatgtgctctacatgtctcttcaccgtcacgataatggaaacttcttccctggc
accggatctgtcactgaaattggaaagggggctggaaaaggtttttcagtgaacatcccc
ttctccggaggcgtcatgaaggatgccgagtaccttgccgcatggagaactgtcgtggaa
ccagtgctggctagcttctgtccagacttcatcttagtctccgctggcttcgacgcttgt
catggacatgtgaacgctctcggaggttatgaaatcactccagagatgtttggatacatg
accaagtgtcttttgagctatgccaatggaaaggtggtcctggcactcgaaggaggatac
aatttagatagcatttctgctgctgctgagcagtgtgtgcaggctctaatcggcgaatct
gacgatgctggtcgcttgtgcacggattcgttggagaacttgccgaatcaaagcgcactg
gagacactacaaaaggttattgctattcataaaggcttctggcctgcattgcacggacaa
gaagctgcaattaacacaacggaaatgcaatggagaaatgtgaaactgcaagtgcaaatg
cagcagcagcaacaacttcaacagcagctccaacaataa

DBGET integrated database retrieval system