KEGG   Caenorhabditis briggsae: CBG16681Help
Entry
CBG16681          CDS       T01054                                 

Definition
Hypothetical protein CBG16681
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CBG16681
Enzymes [BR:cbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CBG16681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 616 aa AA seqDB search
MLFDRRIFALVVVVCLSAIHAEETDEELNYEMDEGVVVLTDKNFDAFLKKNPSTLVKFYA
PWCGHCKHLAPEYEKATSRVSIPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPTDYD
GGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKL
APEYEKAAQKLKAQGSKVRLGKVDATIEKDLGTKYGVSGYPTMKVIRNGRRFDYNGPREA
AGIVKYMTEQSKPAATKLAKLKDIERFMSKDDVTIIGFFATEDSSAFEAFSDSAEMLREE
FKTMGHTSDPAAFKKWDAKPNDIIIFYPSLFHSKFEPKSRTYNKASATSEDLLAFFREHS
APLVGKMTKKNAATRYTKKPLVVVYYNADFSVQYREGSEYWRQKVLNIAQKYQKDKYRFA
VADEEEFTTELSELGLGDSGLEHNVVVFGYDGKKYPMNPDDFDGELDENLEAFMKQISSG
KAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFEPKYKEL
AQALKKSQPNVVLAKMDATINDAPSQFAVEGFPTIYFAPSGKKTEPIKYSGNRDLEDLKK
FMTKHGVKSFQKKDEL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcgaccggcgcatttttgctctggtcgtcgtggtctgcctttcggcgatccat
gcagaagagacggatgaggagttgaattatgagatggatgaaggagtcgttgtgcttaca
gacaagaactttgatgctttcttgaaaaagaacccaagcactttggtcaaattttatgct
ccatggtgtggtcattgcaaacatttggcaccggaatacgagaaagccacatcgagggtt
tcgatccctcttgcgaaagttgatgctactgttgagacggagcttggaaagagattcgaa
attcaaggttatccaactcttaaattctggaaggacggaaaaggaccaaccgattacgat
ggaggaagagatgaggcaggaatcgttgaatgggttgaatcgagagttgatccaaattac
aagccaccaccagaggaggttgtcacattgacaactgaaaactttgatgacttcatctca
aacaacgaattggttcttgttgagttctacgctccatggtgtggacattgcaagaaattg
gctccagaatatgagaaggccgcccagaagctgaaggctcaaggatctaaagtcagactt
ggaaaggttgatgcgactattgaaaaggatttgggaaccaagtacggtgtaagcggatat
ccaacaatgaaggttatcagaaatggaagaagattcgattataatggtcctcgtgaagct
gctggaatcgtcaagtatatgactgagcaatcaaaaccagctgctactaaactcgctaaa
ctgaaagacattgagcgtttcatgagcaaagatgacgtcaccatcatcggattctttgcc
accgaagattcatccgcctttgaagcgttctctgattccgctgaaatgcttcgtgaagag
tttaagacaatgggacatacatcagatccagctgctttcaagaaatgggatgccaagcca
aacgatattatcatcttctacccatcccttttccacagcaaattcgagccaaagagcaga
acctacaataaggcatctgctacttctgaggatctattggcattcttccgtgagcactca
gcaccacttgttggaaagatgaccaagaaaaatgctgctacaagatacacaaagaagcca
ttggttgtggtttactacaatgctgatttctcggttcaatacagagaaggaagtgaatac
tggagacagaaagttctgaacattgctcagaagtaccagaaggataagtacagattcgca
gtggccgatgaggaagagtttaccactgagctctccgaacttggacttggagattctgga
ctcgagcacaacgttgttgtctttggttatgatggaaagaagtacccaatgaatccagat
gatttcgatggagagcttgacgaaaatctcgaggcattcatgaaacaaatcagcagtgga
aaggcaaaggctcatgtcaagagtgctccagctccaaaagacgataagggaccagtgaag
acagtggttggatcaaactttgataagattgtcaacgatgaatcgaaggatgtgctcatc
gagttctatgctccatggtgtggtcactgcaagagctttgagccaaagtacaaggaactt
gctcaggcattgaaaaagtcccaaccaaatgtggtcctagctaaaatggatgccactatc
aacgatgcaccaagtcaatttgctgttgaaggattcccaaccatctacttcgctccatct
ggaaagaagactgaaccaatcaagtactctggaaatcgcgatcttgaagacctcaagaag
ttcatgacgaagcatggagtgaaatcattccagaagaaggatgagctgtaa

DBGET integrated database retrieval system