KEGG   Caenorhabditis briggsae: CBG16797Help
Entry
CBG16797          CDS       T01054                                 

Definition
Hypothetical protein CBG16797
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cbr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cbr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 169 aa AA seqDB search
MATGTIYDFQVKDAAGDLVSLDKYSGLVVIIVNVASYCGLTNSNYDQLKTLNDKYYSRGL
RVAAFPCNQFGFQEPFCEADVSNFVKEKFAFEPDLYGKVLVNGGPLIGGADPLWEFLKKE
QGGTLFDAIKWNFTKFLVNRKGKVVARYGPSTDPKSFENEIERLLAEKP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgggacaatatacgactttcaagtgaaagatgcggctggagatttagtctca
ctggataagtacagtggtctggttgtcatcattgtgaatgttgcatcatattgtggactg
acgaattccaattatgatcagttgaagactctaaacgataaatattattctcgtggcctt
cgtgtggctgcattcccgtgtaaccaattcggttttcaggaaccattctgcgaagctgat
gtcagcaactttgttaaggaaaaatttgcatttgagcctgatctctacggaaaagttttg
gtgaatggaggaccgctgattggaggagcagatccactttgggagtttttaaaaaaagag
caaggaggaaccctatttgatgctatcaagtggaatttcaccaaatttctggtgaacaga
aagggaaaagttgttgccagatacggcccatcgacagatccaaagagttttgagaacgaa
attgaaagacttcttgcagaaaaaccgtga

DBGET integrated database retrieval system