KEGG   Caenorhabditis briggsae: CBG16802Help
Entry
CBG16802          CDS       T01054                                 

Gene name
Cbr-sek-1
Definition
C. briggsae CBR-SEK-1 protein
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG16802 (Cbr-sek-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CBG16802 (Cbr-sek-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CBG16802 (Cbr-sek-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 336 aa AA seqDB search
MDRKGRERKFPGMKIVMPQPVETPTMNLEDRCLIKLTNESEEIEIAATDLIVLEELGKGG
YGIVEKMQHRQSGLIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREG
DVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPS
NILLNRHGQVKICDFGISGHLTNSLAKTVQAGCKPYMPPERIDGETKTAYDVRADVWSLG
ITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPSESGFSADCQFFVKRCLEKNYADRP
KYPELLAMPFMEMARNEKQFSMARFINEILDTPMRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtaaaggacgtgaacgcaagtttcctggcatgaaaatcgtgatgccacagccg
gtcgagacgccaacaatgaatctggaagacagatgtcttatcaagctgacaaacgaatcc
gaggagattgagattgccgccactgacctaatcgtcctcgaggaacttggtaaaggaggt
tacgggattgtggagaagatgcagcacagacaaagtggacttatcatggcagtgaagcgt
atcaaatcatccatcaacgatcagtctcaaaagcagatgctcaacgagctcgacgcgtgc
agaagaagtgattgctgtccgcagatggttcgattctatggtgcaatgttccgcgaggga
gacgtttggatttgtatggaagtcatggacacgtcactcgacaaattctatcgtcacgct
tacaagattggaaagcacattccggaaccattcatcggaaagatggctctttctgtgatc
gagggattgaatttcatgaaggagcaattgaatttgattcaccgtgatgtgaaaccatcg
aacatcttgctcaatcgtcatggacaagtcaaaatttgcgatttcggaatttcgggtcac
ttgacaaacagcttggcaaagactgttcaagccggatgcaagccatatatgccaccagag
agaatcgacggcgagacgaaaactgcatatgacgtcagagccgacgtgtggagtcttgga
attaccatcatcgagattgctgtaggaactcatccatacgccaactggaagacaccattt
gaacagttgaagcaagtcgtcaaggagccaccaccaaagcttccatcggaatctggattt
agtgccgattgtcaattcttcgtcaagcgatgtcttgagaagaactatgctgaccgtcca
aagtatccagagctcctagctatgccgttcatggagatggctagaaacgagaaacaattc
agcatggctcgtttcattaacgagatcctcgacactccaatgcgacgataa

DBGET integrated database retrieval system