KEGG   Caenorhabditis briggsae: CBG16802Help
Entry
CBG16802          CDS       T01054                                 

Gene name
Cbr-sek-1
Definition
C. briggsae CBR-SEK-1 protein
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 336 aa AA seqDB search
MDRKGRERKFPGMKIVMPQPVETPTMNLEDRCLIKLTNESEEIEIAATDLIVLEELGKGG
YGIVEKMQHRQSGLIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREG
DVWICMEVMDTSLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPS
NILLNRHGQVKICDFGISGHLTNSLAKTVQAGCKPYMPPERIDGETKTAYDVRADVWSLG
ITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPSESGFSADCQFFVKRCLEKNYADRP
KYPELLAMPFMEMARNEKQFSMARFINEILDTPMRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtaaaggacgtgaacgcaagtttcctggcatgaaaatcgtgatgccacagccg
gtcgagacgccaacaatgaatctggaagacagatgtcttatcaagctgacaaacgaatcc
gaggagattgagattgccgccactgacctaatcgtcctcgaggaacttggtaaaggaggt
tacgggattgtggagaagatgcagcacagacaaagtggacttatcatggcagtgaagcgt
atcaaatcatccatcaacgatcagtctcaaaagcagatgctcaacgagctcgacgcgtgc
agaagaagtgattgctgtccgcagatggttcgattctatggtgcaatgttccgcgaggga
gacgtttggatttgtatggaagtcatggacacgtcactcgacaaattctatcgtcacgct
tacaagattggaaagcacattccggaaccattcatcggaaagatggctctttctgtgatc
gagggattgaatttcatgaaggagcaattgaatttgattcaccgtgatgtgaaaccatcg
aacatcttgctcaatcgtcatggacaagtcaaaatttgcgatttcggaatttcgggtcac
ttgacaaacagcttggcaaagactgttcaagccggatgcaagccatatatgccaccagag
agaatcgacggcgagacgaaaactgcatatgacgtcagagccgacgtgtggagtcttgga
attaccatcatcgagattgctgtaggaactcatccatacgccaactggaagacaccattt
gaacagttgaagcaagtcgtcaaggagccaccaccaaagcttccatcggaatctggattt
agtgccgattgtcaattcttcgtcaagcgatgtcttgagaagaactatgctgaccgtcca
aagtatccagagctcctagctatgccgttcatggagatggctagaaacgagaaacaattc
agcatggctcgtttcattaacgagatcctcgacactccaatgcgacgataa

DBGET integrated database retrieval system