KEGG   Caenorhabditis briggsae: CBG17050Help
Entry
CBG17050          CDS       T01054                                 

Definition
Hypothetical protein CBG17050
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG17050
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG17050
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG17050
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CBG17050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 495 aa AA seqDB search
SDCNQKQFKSGTVCVCDLTNCDEIPKIDLTSGQAATFTTTNAGARLHRDIVYATSSDPVT
SLHLTIDSSTKYQTIQGFGSTFSDASGANLKSLPDRLADTVIQQYFSDFGLNLQYARVPI
ASNDFSSRVYTYNDVPDDYSMTHFALQREDYQWKIPYMQMAQKYNHDLKFFAVPWSAPGW
LKTTNSTAGYGSLLGSNQGTYHKAYVSYLIKFFEEYNKQGIQFWGLSTQNQPTLGSDKKT
KMQSMLFTAETQRDFIKLDLGPALKASSVAKSLKVLIMDDNRGNLPKWADTVLKDSETAS
YVAGVGVHSYQDDQSDKHLIATHENHPDYFIFGTEASEGYKAKEQSVDYGSWDRAEDYVS
DIVDDLNNWVAGWTERNLILDAQGGPSWVSDFTDAPIIAFPALAQFYKQPMFYAIAHFSH
FLKPGAVRIDHSLNVPNFDIQKSAFLNPDGSKVVVLQNKNILASYGISVKDSQRSSDHYQ
VHMGPRSIVTLYIQN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
tcggactgcaaccaaaagcagttcaaatcgggtactgtatgcgtctgtgacctcacgaat
tgtgatgagatcccaaaaatcgatttgacctccggacaagctgccacgttcaccacaacg
aacgctggagcgagattacatcgggatattgtgtatgcgactagtagtgatccagtaacc
tctctgcacttgaccattgactcttctaccaagtaccaaacgattcaaggattcgggtcc
acgttctcagatgcttctggagccaatctcaaaagtcttcccgacagactagcagataca
gtaatccaacagtatttttcggattttggtctcaacctacagtatgctcgggttccaatc
gctagtaatgatttttcaagtcgagtttatacttataacgatgttcccgacgactacagt
atgacgcatttcgcacttcaacgggaagattatcagtggaagattccctacatgcaaatg
gcccaaaaatacaatcacgacttgaaattctttgctgttccatggagcgcaccaggctgg
ctaaaaacgaccaactcgactgcgggatacggtagcttgttgggctccaatcaaggcact
tatcacaaagcctacgtgtcctatctaatcaaatttttcgaggaatacaacaaacaagga
atccaattttgggggttgagcactcaaaatcagccaacccttgggtcggataaaaagacc
aaaatgcagtcgatgctattcactgctgagacacaaagagatttcataaaattggacctc
ggaccggctttaaaagcctcaagtgtcgcgaaaagcctaaaagtgctaattatggatgat
aatcgaggaaatttgccgaaatgggcggatacggttctcaaagactctgaaactgcttca
tatgttgctggcgtcggcgtccattcgtatcaagacgatcagagtgataagcatttgata
gcaacccatgaaaaccatccggattattttatttttggaacggaggccagtgagggctac
aaagccaaggagcaatctgtggattacggtagctgggatcgtgccgaggactatgtgtca
gatattgttgatgacttgaacaattgggttgctggatggaccgagaggaatttgatcctg
gatgctcagggtggaccatcatgggtttccgatttcacagatgcaccaattattgccttc
ccagcattggctcagttctacaaacagccaatgttctacgcgattgctcattttagccat
ttcctaaaacccggagccgtgcgaatcgatcattctctcaatgtaccaaacttcgacatt
caaaaaagtgcattcttgaatccggatggctcgaaagtggtggtccttcaaaataagaac
attctggcgtcctatggtatcagtgtgaaggattctcaacggtcatcagatcattatcaa
gttcatatgggtccaagatcgattgtaactttgtatattcaaaattag

DBGET integrated database retrieval system