KEGG   Caenorhabditis briggsae: CBG17050Help
Entry
CBG17050          CDS       T01054                                 

Definition
Hypothetical protein CBG17050
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cbr00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cbr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cbr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 495 aa AA seqDB search
SDCNQKQFKSGTVCVCDLTNCDEIPKIDLTSGQAATFTTTNAGARLHRDIVYATSSDPVT
SLHLTIDSSTKYQTIQGFGSTFSDASGANLKSLPDRLADTVIQQYFSDFGLNLQYARVPI
ASNDFSSRVYTYNDVPDDYSMTHFALQREDYQWKIPYMQMAQKYNHDLKFFAVPWSAPGW
LKTTNSTAGYGSLLGSNQGTYHKAYVSYLIKFFEEYNKQGIQFWGLSTQNQPTLGSDKKT
KMQSMLFTAETQRDFIKLDLGPALKASSVAKSLKVLIMDDNRGNLPKWADTVLKDSETAS
YVAGVGVHSYQDDQSDKHLIATHENHPDYFIFGTEASEGYKAKEQSVDYGSWDRAEDYVS
DIVDDLNNWVAGWTERNLILDAQGGPSWVSDFTDAPIIAFPALAQFYKQPMFYAIAHFSH
FLKPGAVRIDHSLNVPNFDIQKSAFLNPDGSKVVVLQNKNILASYGISVKDSQRSSDHYQ
VHMGPRSIVTLYIQN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
tcggactgcaaccaaaagcagttcaaatcgggtactgtatgcgtctgtgacctcacgaat
tgtgatgagatcccaaaaatcgatttgacctccggacaagctgccacgttcaccacaacg
aacgctggagcgagattacatcgggatattgtgtatgcgactagtagtgatccagtaacc
tctctgcacttgaccattgactcttctaccaagtaccaaacgattcaaggattcgggtcc
acgttctcagatgcttctggagccaatctcaaaagtcttcccgacagactagcagataca
gtaatccaacagtatttttcggattttggtctcaacctacagtatgctcgggttccaatc
gctagtaatgatttttcaagtcgagtttatacttataacgatgttcccgacgactacagt
atgacgcatttcgcacttcaacgggaagattatcagtggaagattccctacatgcaaatg
gcccaaaaatacaatcacgacttgaaattctttgctgttccatggagcgcaccaggctgg
ctaaaaacgaccaactcgactgcgggatacggtagcttgttgggctccaatcaaggcact
tatcacaaagcctacgtgtcctatctaatcaaatttttcgaggaatacaacaaacaagga
atccaattttgggggttgagcactcaaaatcagccaacccttgggtcggataaaaagacc
aaaatgcagtcgatgctattcactgctgagacacaaagagatttcataaaattggacctc
ggaccggctttaaaagcctcaagtgtcgcgaaaagcctaaaagtgctaattatggatgat
aatcgaggaaatttgccgaaatgggcggatacggttctcaaagactctgaaactgcttca
tatgttgctggcgtcggcgtccattcgtatcaagacgatcagagtgataagcatttgata
gcaacccatgaaaaccatccggattattttatttttggaacggaggccagtgagggctac
aaagccaaggagcaatctgtggattacggtagctgggatcgtgccgaggactatgtgtca
gatattgttgatgacttgaacaattgggttgctggatggaccgagaggaatttgatcctg
gatgctcagggtggaccatcatgggtttccgatttcacagatgcaccaattattgccttc
ccagcattggctcagttctacaaacagccaatgttctacgcgattgctcattttagccat
ttcctaaaacccggagccgtgcgaatcgatcattctctcaatgtaccaaacttcgacatt
caaaaaagtgcattcttgaatccggatggctcgaaagtggtggtccttcaaaataagaac
attctggcgtcctatggtatcagtgtgaaggattctcaacggtcatcagatcattatcaa
gttcatatgggtccaagatcgattgtaactttgtatattcaaaattag

DBGET integrated database retrieval system