KEGG   Caenorhabditis briggsae: CBG17056Help
Entry
CBG17056          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG17056
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00511  Other glycan degradation
cbr00600  Sphingolipid metabolism
cbr01100  Metabolic pathways
cbr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG17056
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG17056
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG17056
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CBG17056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-GeneID: 8574086
NCBI-ProteinID: XP_002632088
WormBase: CBG17056
Position
II
AA seq 524 aa AA seqDB search
MTIFKKKVPNGSVGFDTEIYGPQDFVSAADCTQKSFKTGTVCVCSLDSCDEIPALDITMG
QAALYTTSNSGARLHRDLVYATDAEPFGTLHMTIDSSKKYQTIQGFGSTFSDASGANLKS
LPDKLADTVIRQYFSESGLNLQFGRVPMASTDFSGRVYSYNDVPEDYMMKNFNLTREDFQ
WKIPYIQAAKRYNPNLKLFGAPWSAPGWMKTTKEMSGPGALNGHAGDNYHKAYATYFVRF
LEEYSKSGINFWALSTQNQPTLGSDKKNKIQSTLFTAETQRDFIKSDLGPALKGKNVTLL
IMDDNRGNLPKWADTVLNDQDAARYVSGIGVHSYQDSETDKHLDDTHKKHSNFFILGTEA
SEGGGAKEQSVDYGSWERAEDTVSDILDDLNNWVVGWTERNLILDAQGGPSWVSDFADAP
IIAFPALAQFYKQPMFYAIAHFSHFIKPGAVRIDHSLNVIELEVESAAFLNPDGSKVIIM
LNKAALVSTEHTVVVQDAADNRNHYQFKLPHRSITTLYIQTSNF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttcaaaaaaaaagtgccaaatggctcagtgggttttgataccgaaatctat
ggtccacaagatttcgtatcagctgctgattgcacacagaaatcgttcaaaactggtacg
gtttgcgtttgtagtttggacagttgcgatgagattccggctctggacatcacaatgggt
caggcagccctctacaccacctctaatagtggggcacgcctacaccgggatctggtatat
gcgactgacgcagagccttttgggaccctccacatgacaattgattcctcgaaaaagtat
caaacgattcaaggatttgggtccacgttctcagatgcttctggagccaatctcaaaagt
cttcccgacaaattagcggatactgtaatccgacagtatttctcggagagtggtctcaac
ttgcagttcggtcgtgttccgatggctagcaccgatttttcgggacgagtttatagttat
aatgatgtcccagaagattatatgatgaagaatttcaatttgactagggaggattttcag
tggaagatcccctatattcaagccgcgaagagatacaacccgaatttgaagctttttggt
gctccgtggagtgctccgggttggatgaaaacgacgaaagaaatgtcgggaccaggagcg
ctgaacgggcatgctggtgataattatcataaggcatatgcaacctactttgtgagattc
ctagaagaatactcaaaatctggaatcaatttttgggcgctgagcactcaaaatcagcca
actttagggtcggataagaagaataaaattcaatcgacacttttcacggccgaaactcaa
agagattttatcaaatccgatcttggaccggccttaaaaggaaaaaatgtcacattactg
ataatggatgataatcgtggaaatttgccgaaatgggcggatacggtgctcaacgatcaa
gacgccgccagatacgtctctggaatcggggtgcattcttatcaagactctgaaactgat
aaacatttggatgatacccacaaaaaacactcaaatttctttattctaggtactgaggcc
agcgaagggggcggagccaaggagcaatctgtggattacggtagctgggagcgtgccgag
gatacggtttccgatattttggatgacttaaataattgggtcgtcggatggaccgagcgg
aatctgatcctggatgcccagggtggaccatcgtgggtttccgattttgccgatgcacca
attattgccttcccagcattggctcagttctacaaacagccaatgttctacgcaattgct
cattttagccacttcatcaagcctggggccgtccgaattgaccattccctcaacgtcatt
gagctggaagttgagtcagccgcatttttgaatccagatgggtccaaagtgatcattatg
ctgaataaggctgcgttggtttccacggagcatactgtagttgtgcaggacgctgctgat
aatcgcaaccattatcaattcaaacttccacacagaagtatcactacattgtacattcaa
acttcgaatttttga

DBGET integrated database retrieval system