KEGG   Caenorhabditis briggsae: CBG17587Help
Entry
CBG17587          CDS       T01054                                 

Gene name
Cbr-plc-1
Definition
C. briggsae CBR-PLC-1 protein
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cbr00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cbr04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cbr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 1896 aa AA seqDB search
MNWDTLKSVLKTRRLTKRTIPAYIHPTSRSDSTSSTQSATAGFILNEEPITLFRLELERL
QYILHFPEEVAFQLSSTEYQLFYSIQPMDYVRYVSCDLTSVPVSENPSPVRNLVKRLSEV
SSWITHVIVSQPTHDDRKVALTAILRIVETCWNIGNFNAAVEVLMGLKSEKLRPFWLSLR
QEEKSQFDSLCETLLPANQALPSQAYINAVQRALRMPQSRVIPFFGIFLRDLYAIVNDLP
NIVVIGQEGETQKLEFMSDPNGEDHFSSRIGVGGLLNADKINLVAIVLDNLELFHRHSRT
MIKMLEDQAIATTQIPQNEREQKEKETKTYEPVQVVRGSSHGVALIPLDTLTFDLDVIQR
LQHGTTVIHYEPDSGRSNLCLLRLDPSCGQINWHKISYSVNRDPKEKDVLAKVSVANLQP
LDSGRGAASPMPSGRAPGTGGVGVEEGELKLSVVKGVELVDSYDIDIEAIYRRHSMEEMS
VPVSCWKVSHGQLLSDNEFIYFLAPQQIAFWTNGLQSVVKSLQGQQRYPDRRMLWIKNVY
LSLYEITGEANCGPRPFEALQAFGLSQTNTSATRPNDSSLSSEPGGAKSRLKNLKNAMQK
KLRGASREGSRSQSPQPHSPLVRPPSIKSQISSQSGPPGPNSPGYLLKPRGEPANSDAGD
LDSIYTPRSRTPTSSSYGGRSVGGRSCKSWRSRGGETPNSGSISSSGQMSIQVSGLSGPS
GKEFQEKPLTLVEFAELFRLFNTRMRKDLRDVFNDVLSTATTPQHCPKRERDRHSPRMQS
RLASVSNSYNADFLSNDFLTKNTTVSSHHISEKQNKIYNALALASVNSMGGLMDTSRSSM
LTPQMLRAFVNTHQMEQIDEATANKLIQDHEPDATCRQKNQMSFEGFTRFLCDPVNFAFV
PETIEPDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDG
DDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKT
VLGDLLVTNFLFEADFSDSPRLPCPLQMKNKILIKNKKMIVDVPTPLPMIDRGAIQRGET
NLTLHRKQSKNSYESSTVDEVEDDDLDEFLDDEENEEDDQEEVPVRGEKDDSPKASKRAE
KSVRNIKQQDSLCSDHSVEQAKPSTSKSASKTNEGKTEDEVLYAQLAQNAIRNQQPRKNN
TGVQIAPELSDIVIYMQATKFKGFPPVEGIQSPRLIVEDPPTSTTSLSFSTRSRTPSTLL
STPAPPRRQRSSTQLSQELQSEYLSSARPNATATCYQVTSLNENAAKKLMKRHPAKCISY
TRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQ
LKPRCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHVYPNTHYASLYVEIEVIGI
HNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNGRVVAHRVVPVKC
IRPGFRHLPLRTSTNLPIDNAMIFLRTRFEQEEHIYLHDDDSNSYCNLEHTLAYRTDLTP
NLSPTPILKKQIFVLRITGAFADETAITVHSESGSTVKTVMQQALLNAGKNADQVEEYVL
IEESLPAPSGEDPIEQRVLPLNEPIMDAVACWNGSMRRFVLRKKGSDPSSRAWITSIIKS
GTGGSSTSVSPSPLIKDGHVKSASNQLHGRSLDTDAEHLEVTEGKWLNPRARSMGDTFLV
CVHNVSEDQPYAILRAGINSTAADIIRQVFVKARRPNVDDAEYVLVEETCDDTKINQGQS
MLQALSLARKRSNDLTPKYPNNRTTSRVLGPNENVWKAQSRWKSMGRFVLENRKDTVHAT
LEKDFLEMAKLLREGIPKKDETYYMIHYAGLPGEDI
NT seq 5691 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggacactttgaaaagcgtgctgaaaacgagacgtttgacaaaacgtaccatc
ccagcttatattcatccaacgtcacgtagtgactccacctcgtccacacaatcagccacc
gccggattcattttaaatgaagaacccatcactttgttccgactcgaactcgaacgacta
cagtacattcttcattttcccgaagaagttgccttccagctttcttctaccgagtatcag
cttttttactccatccaaccgatggattatgttcgttatgtgagctgtgatctgacatcg
gtaccagtttcggagaatccaagtccagttcggaatcttgtcaagcggttgtcagaggtt
tcttcttggatcacccacgtcattgtcagtcagccaacccatgacgaccggaaagtcgcg
ctcactgccatcctcagaattgtggaaacatgttggaacattggaaattttaatgcagca
gtagaagttctaatgggacttaagagcgagaagctaagaccattctggttgtcccttcga
caggaagaaaagtctcaattcgattcactctgtgaaacactgctgccggccaaccaagca
cttccgtcacaagcctacatcaacgcagtccagcgtgctctccggatgcctcaatctcgt
gtcattccatttttcggaatcttccttcgcgatctctacgccattgtcaacgatttgccg
aacattgtggtgattggacaagaaggcgaaacgcagaagctcgagtttatgagcgatccc
aacggagaggatcatttctcgtctagaatcggagttggcggcctgttgaatgccgataaa
atcaatttggttgctattgtactggacaacttggaactgttccaccggcatagtcgaact
atgatcaagatgctggaggatcaagctatcgccaccactcagattccgcagaatgagcga
gaacaaaaagaaaaagaaacgaagacctatgaaccagtgcaagtggttcgtggttcctct
catggagtggctcttatcccacttgacacactgaccttcgaccttgacgtcatccaacgt
ctccaacacggaacaacagtcatccactatgagccagactcgggacgaagcaatctgtgt
ctgctcagacttgatccaagttgtggacaaatcaactggcataaaatctcctactctgtg
aacagagatcccaaggaaaaagatgtgcttgccaaagtgtccgttgcaaatctccaacca
cttgactcaggtcgtggtgctgcgtctccaatgccatctggaagagctccgggaacagga
ggtgtaggagttgaagaaggagaactcaaattaagtgttgtgaagggcgttgaactggtt
gatagctacgatattgacattgaggctatttatcggcgtcattctatggaagaaatgtcg
gttccggtcagttgctggaaagtcagtcatggacagttgctttctgataacgagtttatc
tatttcctggcaccccagcaaatcgccttttggacgaacgggttacaatctgtggtaaaa
agtcttcaaggacaacaaagatacccggaccgtcgtatgttgtggatcaaaaatgtgtac
ctgtccttgtatgagatcaccggtgaagccaactgcggaccacgaccgttcgaagcactt
caagcatttgggttgagccaaacgaatacaagtgcaactcgacccaatgactcgtcgttg
tccagtgagccaggaggtgcaaagagcagactaaaaaatctgaaaaatgccatgcaaaag
aagctccgcggagcatctcgagaaggatcccgatcccaatctccacaaccacactctcca
cttgttcgtccgccatcgatcaaatctcaaatatcctcccaatccggtccaccaggtccc
aactctcctggatacttgttaaagccacgtggcgagccagcaaacagtgacgccggagac
ctggatagtatctacacgccaagatcaaggacaccgacgagcagttcctatggaggtcgc
tctgtcggaggaagatcgtgcaaatcatggcgatcacgtggtggagaaactcccaactct
ggctccatcagcagttccggtcaaatgtcaattcaagtctctggcctaagcggtccatcc
ggaaaagagttccaagagaaaccactgactcttgtggagtttgcagagctcttccgactc
tttaacaccagaatgaggaaggatttgagagatgtgttcaatgatgtcttatccaccgcc
accacaccacaacactgtccaaaacgggaacgcgatcgtcacagccccagaatgcagtcc
agacttgctagtgtctcgaattcatacaacgccgattttctgtcaaatgatttcctcacc
aagaacacgacagtgagctcacatcacatcagcgagaagcagaacaaaatctataatgct
cttgcacttgccagtgttaatagcatgggcggactcatggacacatcgcgatcatcaatg
ctcacaccgcaaatgctccgcgcgtttgtcaacactcatcaaatggagcaaattgacgag
gcaacggcgaacaagttaattcaggatcatgagccggatgccacatgtcgtcagaaaaat
caaatgtctttcgagggattcacgcgcttcttgtgcgacccggtcaattttgcattcgtg
ccggaaaccatcgagcccgatgaggaagatttgcgctacccactatcgcattattacatc
aactcgagccacaacacttatctgacgggacaccaattgaagggacccagcagttccgag
atgtacagacaggttctcctcaccgggtgccgttgcgtagagcttgactgttgggacggc
gatgatggattaccactcatctatcacggacacactcttgttagcaaaattggatttaga
caggtcgttgaaatcatcaaaaaatccgctttcatcacttcggatcttcccgtgattcta
tccatcgagaatcattgttcgctccaacaacaggcaaaaatggcacaaatgttcaagacg
gtgctcggcgatttgttggttacaaacttcctctttgaagccgacttctcagattctcca
aggctaccatgccctctccagatgaaaaataagattctgattaagaacaagaaaatgatc
gtggatgttcctactcccttaccaatgattgatagaggagccattcagcgtggagagacg
aatctgactttgcacagaaagcagagcaagaattcgtacgagagcagcactgttgatgaa
gtggaggatgacgacttagacgagttcctggatgatgaagaaaatgaggaagatgaccag
gaagaagttccagttcgtggcgagaaggatgacagtccgaaggcatcaaaacgtgctgag
aaatcagtgagaaacatcaaacaacaagactccctgtgcagtgatcattcggtagagcaa
gcgaagccatcaaccagcaagagtgcatccaagaccaacgagggaaagactgaagatgaa
gtgctttatgctcaattagcacagaatgccatccgcaaccagcaaccgcgaaagaacaac
actggagtccagattgctcccgagctctcggacattgtcatttacatgcaagccactaag
tttaaaggattcccaccagttgaaggcattcaatctcctcggttgatagtggaagatcct
cctacatcaaccaccagcctatcgttctcaacaagatccagaacaccatcaacccttctg
agtacgcctgctccaccgcgacgtcagaggagtagcacccagttgagtcaggagcttcaa
tccgagtatttgtctagtgcaagaccaaatgcaactgccacatgctatcaagtcacctcg
ttgaatgagaatgcagcaaagaaactgatgaagcgtcatccagcgaaatgcatttcctac
actagagatcatctgatccgaacatatccaagtgccaagcactacgactcatctaacttc
aaccctatcaactgctgggctcatggaatgcaaatggttgcactcaacttccaaacacct
gatgtcataatggctgtaaatcaagcaatgttcgagcagagtggaaactgtggctatcag
ttgaagccaagatgtctttgggatgaatctcacttgttgtataataaattcttgccgctc
tccaaggatattgctggacattcggcgttgctgctgaatttgacgatcatctctggccaa
cacgtctatccaaacactcactacgctagtctctacgttgaaattgaagtgatcggaatt
cacaacgattgtgtccgtgaaaaatccaaagttgtccagagaaattctgtgaatccgatc
tggaatcacactacacagctacgcattgcttgtgttgatctggcattcctccgaatcgcc
gtatgtgacagtggccaaaacggacgggttgttgctcatcgagtggtgcctgtcaaatgc
attcgacccggtttccgacatcttccgcttcgcacatccacgaatcttccaattgacaat
gccatgatctttttgagaactcgattcgagcaagaagagcacatctacctccacgacgat
gactcaaactcttattgtaatttggagcacacactggcttatcgaactgatttgactccg
aacctctcacccacgccaattttgaaaaagcaaatcttcgtgcttcgcatcactggcgcg
tttgccgatgagaccgcaattactgtacacagtgaatcgggtagtacggtaaagacagtg
atgcagcaagcgctgctgaatgccggaaagaatgcggaccaagttgaggagtatgtattg
attgaggagtcgctgccagcaccgtcaggagaagatccgattgagcagagggtgcttcct
ctaaacgagccgataatggacgctgttgcttgctggaacggatcgatgcgacgcttcgta
ttacgcaaaaaaggaagtgacccatcctcccgagcttggataacatcaatcataaaatct
ggaaccggtggtagttcaacgtcagtttcaccaagtccacttatcaaagatggacatgtt
aaaagtgcaagcaatcagctacacggacgctcattggacactgacgctgagcaccttgaa
gtgacagaaggcaagtggttgaatccacgtgcgcgatcgatgggcgacactttcttggta
tgtgttcataatgtgagcgaagatcagccgtatgcaattctgagggctggaattaacagc
acagcagcagatattattcgacaggtgtttgtgaaagctcggcgtccaaacgttgatgat
gccgaatacgtgctggtcgaagaaacgtgtgatgacacaaaaattaatcaaggtcaaagt
atgcttcaagcactttcgctggcgcgaaaaaggagcaatgatctcactccaaaatatccc
aacaaccgaaccacgagccgagtgttgggtccaaatgaaaacgtgtggaaggcgcaatct
cgatggaaatccatgggccgtttcgtgctcgagaaccgaaaggatactgtacacgcgaca
ctcgaaaaagattttctggaaatggcaaagttgttgcgagagggtataccgaaaaaagac
gagacttattacatgatccattatgccggactaccaggagaagacatttga

DBGET integrated database retrieval system