KEGG   Caenorhabditis briggsae: CBG17764Help
Entry
CBG17764          CDS       T01054                                 

Gene name
Cbr-cyh-1
Definition
C. briggsae CBR-CYH-1 protein
Orthology
K06634  
cyclin H
Organism
cbr  Caenorhabditis briggsae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cbr03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cbr03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 293 aa AA seqDB search
ITPEELELFVTPEEELRMQRSIEDAALKFADKFRPHIWPSVKWTALAFFKRAFLVWVPSD
TSIRMVMMGCFYLAMKIDEFYITIDDFVKNMNVGDPRQNAERILKLEPELMKVLNYNLTV
HCPYRPFEGHLMDMKTRMLLLNFDLESIRRDSMRFFQNALQTDVLLVYPPSQIALAAINF
GHAQGKSDEILREFLRKMIGIEEDSWSARDVRPEDLEKLEKTVTRVNHIMREVEKQFVAV
TEQERENHKSRLSQIQNLLPILNERRKEAWRAGGCIGQEPGLVTEAPVDSDDE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atcacaccggaggagttggagctgttcgtgactccagaagaggagcttcggatgcagaga
tccattgaggatgcggcgttaaaattcgccgacaaatttcgcccacacatatggccatcg
gtgaaatggaccgctttggcattcttcaagagagccttcttggtgtgggttccatccgat
acgtccatcagaatggtaatgatgggctgcttctatctcgccatgaagatcgacgagttt
tatatcactattgatgattttgtcaagaacatgaatgtgggcgaccctcgtcaaaatgcc
gaacgaattctgaagctggagccggaattgatgaaagttctgaattacaaccttaccgta
cactgcccatatcgtccgttcgaaggtcatctgatggatatgaagactcgaatgcttctg
ctgaatttcgacctcgaatcaattcgtagggactcgatgaggttcttccagaatgccctg
caaacggacgttcttcttgtctacccaccatctcagattgcattggctgctatcaatttt
ggccatgctcaaggaaagtcggatgagattctcagagagtttctgagaaaaatgattggg
atcgaggaggattcgtggtcggccagagatgtgagaccagaggatttggaaaagttggag
aagactgtcactagagtcaaccacatcatgagagaagtcgagaagcaattcgtggcagtg
actgagcaggagagagaaaaccataagagccgcctgtcccaaatccaaaatcttcttcca
attctcaacgaacgccgaaaagaggcgtggcgagccggcggatgcatcggacaagagcca
ggccttgtcactgaagcgccagtggattcggatgacgagtag

DBGET integrated database retrieval system