KEGG   Caenorhabditis briggsae: CBG17764Help
Entry
CBG17764          CDS       T01054                                 

Gene name
Cbr-cyh-1
Definition
C. briggsae CBR-CYH-1 protein
Orthology
K06634  
cyclin H
Organism
cbr  Caenorhabditis briggsae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CBG17764 (Cbr-cyh-1)
  Replication and repair
   03420 Nucleotide excision repair
    CBG17764 (Cbr-cyh-1)
Transcription machinery [BR:cbr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CBG17764 (Cbr-cyh-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 293 aa AA seqDB search
ITPEELELFVTPEEELRMQRSIEDAALKFADKFRPHIWPSVKWTALAFFKRAFLVWVPSD
TSIRMVMMGCFYLAMKIDEFYITIDDFVKNMNVGDPRQNAERILKLEPELMKVLNYNLTV
HCPYRPFEGHLMDMKTRMLLLNFDLESIRRDSMRFFQNALQTDVLLVYPPSQIALAAINF
GHAQGKSDEILREFLRKMIGIEEDSWSARDVRPEDLEKLEKTVTRVNHIMREVEKQFVAV
TEQERENHKSRLSQIQNLLPILNERRKEAWRAGGCIGQEPGLVTEAPVDSDDE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atcacaccggaggagttggagctgttcgtgactccagaagaggagcttcggatgcagaga
tccattgaggatgcggcgttaaaattcgccgacaaatttcgcccacacatatggccatcg
gtgaaatggaccgctttggcattcttcaagagagccttcttggtgtgggttccatccgat
acgtccatcagaatggtaatgatgggctgcttctatctcgccatgaagatcgacgagttt
tatatcactattgatgattttgtcaagaacatgaatgtgggcgaccctcgtcaaaatgcc
gaacgaattctgaagctggagccggaattgatgaaagttctgaattacaaccttaccgta
cactgcccatatcgtccgttcgaaggtcatctgatggatatgaagactcgaatgcttctg
ctgaatttcgacctcgaatcaattcgtagggactcgatgaggttcttccagaatgccctg
caaacggacgttcttcttgtctacccaccatctcagattgcattggctgctatcaatttt
ggccatgctcaaggaaagtcggatgagattctcagagagtttctgagaaaaatgattggg
atcgaggaggattcgtggtcggccagagatgtgagaccagaggatttggaaaagttggag
aagactgtcactagagtcaaccacatcatgagagaagtcgagaagcaattcgtggcagtg
actgagcaggagagagaaaaccataagagccgcctgtcccaaatccaaaatcttcttcca
attctcaacgaacgccgaaaagaggcgtggcgagccggcggatgcatcggacaagagcca
ggccttgtcactgaagcgccagtggattcggatgacgagtag

DBGET integrated database retrieval system