KEGG   Caenorhabditis briggsae: CBG18010Help
Entry
CBG18010          CDS       T01054                                 

Definition
Hypothetical protein CBG18010
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cbr  Caenorhabditis briggsae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBG18010
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CBG18010
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBG18010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 681 aa AA seqDB search
MSNTRPPKIDELLKVDPYLHDFQDEISRRYGVFLDYQRRIEECGGMEAFTSSYKQFGLNV
QPDNSVKGLEWAPAAEKLALIGDFNNWDQDANVYTKEEHGKWSVTVPANADGSCAIPHNS
VIKIAVSRHGQTYFKLSPWATYVTCPNPKETVIYHQNFWNPSEKYQMKEARPARPASLRI
YEAHVGISSHEGKINTYRAFADEVLPRIKHQGYNTIQLMAVMEHVYYASFGYQVSNFFAV
SSRCGTPEDLKYLVDKAHSMGIFMLLDVVHSHASKNVEDGLNQWDGSNGGYFHDNARGFH
NLWDSRLFDYTQIETLRFLLSNVRWWVEEYGFDGFRFDGVTSMIYHSHGMNDSFCGGYPM
YFGLNADTDSLVYLMLANDFLHKKYPFMVTIAEEVSGMPGICRPVEEGGQGFDYRLAMAL
PDMWIKILKHTSDEDWKIEDIVFNLENRRYAEKHVAYAESHDQALVGDKTIAFWLMDKEM
YDFMSTDSPLTPIIDRGLALHKLIRLITIGLGGEAWLNFIGNEFGHPEWLDFPRVGNGES
FHYARRQFNLVDADYLRYKFLNNWDREMMLLEERTGFLHKGYAYTSWKHDGDKVVVFERG
GLVFVMNLHPNKSFADYSIGVNTAGKYRIALNSDDAQFGGHSRVDNGTVFHTSDDGYAGR
RHRLQVYIPCRSAIVLEKVDE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacactcgtccaccgaaaatagatgagctgctgaaagttgacccatatttgcat
gattttcaagacgaaatttcgcgcagatatggagttttccttgattatcagcgtcgcatt
gaggaatgtggaggcatggaggcattcacctcatcatacaagcaatttggtttgaacgtg
caaccggacaattctgtgaaaggacttgaatgggctcctgcagctgaaaaactggctctc
attggagatttcaataattgggatcaagacgccaatgtttataccaaagaagagcatgga
aaatggagtgtcacagtccccgcgaatgctgatggatcatgtgctattccacataattcg
gtcatcaaaattgcagtctcgcgtcacggtcaaacttacttcaaactgagtccatgggct
acttatgtgacttgcccgaatcccaaagaaacagttatctatcatcagaatttttggaat
ccatccgaaaaatatcagatgaaagaggcacgtccagcccgtccagcgtcgctcagaatc
tatgaagcacatgttggaatcagcagccacgaaggaaaaatcaacacttatcgtgcattt
gccgacgaagtcctgcctcgcatcaaacaccagggatacaatactattcagttgatggct
gtcatggagcatgtttattatgcctcttttggttatcaagtttcgaatttcttcgctgtg
tccagtcgatgcggaacacctgaagacctgaaatatctggtcgataaggcgcattcgatg
ggaattttcatgcttctcgatgttgtgcactctcatgcttccaaaaacgtcgaagacggt
ctcaatcaatgggatggatcaaatggtggatatttccatgataatgctcgtggtttccac
aatctttgggactcgagactgtttgactacactcaaattgagaccctccgattcttgctc
tcgaacgttcgttggtgggtagaagaatacggtttcgatggattccgctttgatggagtt
acctcgatgatctatcactcacatggaatgaacgactcgttctgtggcggatatcccatg
tacttcggattgaatgccgacaccgactcacttgtctatctgatgctggccaacgacttc
cttcataagaaatatccattcatggtgacaatcgctgaagaagtttccggaatgccaggc
atctgtcgtcctgttgaagaaggtggtcagggattcgattaccgcttggcaatggctctc
ccagatatgtggatcaagattctgaagcatacttcggatgaagattggaaaatcgaagat
atcgttttcaatctggagaacagacgttacgcagaaaagcacgttgcctacgccgagtct
catgatcaagctttggttggagacaaaactattgcattttggttgatggacaaggaaatg
tatgactttatgtcaactgactcaccactcacaccaattattgacagaggtttggcactt
cacaagcttatccggcttattacaatcggattaggaggcgaagcttggctcaactttata
ggaaacgaattcggtcaccctgaatggcttgatttccctcgtgttggaaacggagaatcg
ttccattatgcacgtcgtcagttcaacctcgttgacgccgattaccttcgctacaagttc
ttgaacaattgggatcgagaaatgatgcttctcgaagaacgtaccggattccttcataag
ggatacgcctacacatcttggaagcacgatggcgacaaagttgttgtattcgaaagagga
ggtttggtgttcgtgatgaatcttcacccgaacaagagctttgctgattactcgatcggt
gtcaacaccgcgggaaaataccgcattgctttgaactcagatgatgcccagtttggagga
cacagccgtgtggacaatggcactgttttccacacttccgatgatggttatgccggaaga
cgccatcgtctacaggtctatatcccgtgccgttcagcaatcgttctcgagaaggttgat
gaatag

DBGET integrated database retrieval system