KEGG   Caenorhabditis briggsae: CBG18041Help
Entry
CBG18041          CDS       T01054                                 

Definition
Hypothetical protein CBG18041
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cbr  Caenorhabditis briggsae
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBG18041
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBG18041
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CBG18041
Enzymes [BR:cbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CBG18041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 442 aa AA seqDB search
MLRKYSLFYSFRNASTLLSSLDGLTNRTNGDKLLTYSERFSKLYAQTAPETRKALFVNLV
TNYGVNKEALNHAISLYLKNDQMYPEVRTAATATYVNLIKGIGNLSGGVAQVCEMRANIL
ALLKRETDKTTTSYLRHIELATREVLTSWFCLGNLKLERLTWSSPGDILQKVAEYEAVHP
VRGLSDFRKRLGPLRRCFYFSHEALPRNPLVMVHVALVSEIADSVQEITKRGDPTGKEED
QTTSIYYSITSTQAGLSGIDLGNMLIKKVATQLQKDVPSVTTHSTLSPIPGFRPWLIRNL
KGNSEYPSIMNEKVVEWMSELSGRKMTETESTETLLKVISNEKTKKEQLNAIKHILMYAC
AHYLCKAKRNGMALNSVANFHIRNGAELYRMNWNGDTSHRGINNSFGIMVNYRYDLDMVH
ENSAAYTERKQMKINENVSKFL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaaagtattcattgttttactcattccggaatgcttctacattgttatcttct
ttagatggactaaccaaccgaacaaatggagataagttgctgacctacagtgaacgattc
tccaaactatacgcccagactgcaccagaaactaggaaggctttattcgtgaatcttgtc
acgaactatggagtcaataaggaagcgttaaatcatgccatctctctgtatttgaagaac
gaccaaatgtatccagaagtcagaacagcagcaacagctacttatgtcaatctgataaaa
ggtatcggaaatttgtcaggaggagttgctcaagtctgtgaaatgagagcgaacattttg
gcattgttgaaacgggaaacggacaaaacaactacctcatatcttcgacatattgaacta
gcgactcgagaagttctcacctcatggttttgtcttggtaacttaaaactggaaagactg
acgtggtcttctcctggagatattctccaaaaggtagccgagtatgaagcagtgcacccc
gtgagaggactatccgattttcgaaaacgcctcggaccgttgagaagatgtttctacttc
tctcacgaagctcttccgcgcaacccactcgtaatggttcatgttgcattagttagtgaa
atagccgatagtgttcaagagatcaccaaaagaggggatccgactgggaaggaagaagat
cagacgacttctatctactattctatcacttctactcaagctggtctttctggaattgat
ttgggaaacatgttaatcaaaaaagtcgccacacaacttcaaaaagacgttccctcagtg
acaactcattcaaccctatcaccaattcctgggtttaggccttggcttattaggaatttg
aaaggaaattcagaatatccgtcgataatgaatgaaaaagtggtagaatggatgtcagag
ctatctggtagaaagatgaccgaaacggaatcaactgaaactttattgaaagtgataagc
aacgaaaagactaaaaaagagcagctaaatgcaattaaacacattctaatgtatgcatgt
gcccattatctatgtaaagcaaaaaggaatggaatggctttgaattctgttgcgaacttc
catattcgtaatggcgctgaactgtatcgaatgaattggaatggtgatacgagtcatcgt
ggaatcaataatagttttggcatcatggtgaattatcgatacgacctggacatggttcat
gagaatagtgccgcatacactgaaagaaaacaaatgaagataaatgaaaatgtatccaaa
tttttatag

DBGET integrated database retrieval system