KEGG   Caenorhabditis briggsae: CBG18047Help
Entry
CBG18047          CDS       T01054                                 

Gene name
Cbr-ugt-62
Definition
(RefSeq) C. briggsae CBR-UGT-62 protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBG18047 (Cbr-ugt-62)
   00053 Ascorbate and aldarate metabolism
    CBG18047 (Cbr-ugt-62)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG18047 (Cbr-ugt-62)
   00860 Porphyrin and chlorophyll metabolism
    CBG18047 (Cbr-ugt-62)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG18047 (Cbr-ugt-62)
   00982 Drug metabolism - cytochrome P450
    CBG18047 (Cbr-ugt-62)
   00983 Drug metabolism - other enzymes
    CBG18047 (Cbr-ugt-62)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CBG18047 (Cbr-ugt-62)
Glycosyltransferases [BR:cbr01003]
 Others
  Hydrophobic molecule
   CBG18047 (Cbr-ugt-62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 531 aa AA seqDB search
MKIFALLSLLLGAVASYKYVIFVPNMANSQTQFCARVAEVLANGGHDVTMLFVTHLSDFK
TDVKIPKGVKSYHLDAFIEGITKESIEKEQSAMIFKDTGLKDMPAMMAMFGRFGKMLQEG
CRAVIRNKEFMKWLENEKFDVAYAYIYSTCPIGLIHTAKIPSWVWLNSGPLMDYVAETTG
VPIIPSYVPPVMMESHDLMGFVFRTKSFIGHFLMTLFHRKMSSDAETQIFREELNDPSFP
HTMDIGAKCPLIIVNSNELYDLPRPTLAKVVNIGGLGVGFDSAKPLTGEFKTISETGKGM
IVFSFGSVAAAHEMPLEWKNAILDAFSSLPDYQFVMRYLGTDLNDRLPKNVHLSKWLPQK
DLLLHNKTKAFISHGGYNSMQEAISAGVPLVTIALFGDQPKNAQIAKKHGFAVNIQKGTI
SKETIVEALKEVLENDSYKQKVSRLSAMVRAQPMKPAERLLKWSEFLAEFKTLDNLEPAG
QKLNFFQYHSLDVIGFLFTVIFLVFYIFYRILRALVRCCCCRKSHEKKKTE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgctctattatcattgctcctaggagcagtcgcctcctacaaatatgtt
atttttgtaccaaatatggctaatagtcagactcaattctgtgctcgtgtagcagaggtt
cttgccaatggaggtcacgatgtcactatgctcttcgtcactcatttatctgatttcaag
actgatgtgaaaattccaaagggagtcaaaagttaccatctcgatgctttcatagaggga
atcacaaaggaaagcattgagaaagagcaatctgctatgatattcaaagatactggactt
aaagatatgccagctatgatggcaatgttcggtcgctttggaaagatgctccaagaagga
tgtcgcgcagttattagaaacaaggaatttatgaagtggttggaaaatgaaaagtttgat
gttgcatacgcatacatctattctacttgtccaattggattaattcatacagccaagatt
ccatcttgggtttggttaaacagtggaccactcatggactacgttgctgaaacaactgga
gttccaatcattcctagttatgttccacctgtgatgatggaatctcacgatttaatggga
ttcgtttttagaacaaaaagctttattggacatttcttgatgactcttttccacagaaaa
atgtcttccgatgcggaaacgcagatttttcgtgaggaattgaacgatccatctttccca
catacaatggatattggagcaaaatgcccattgatcattgtaaacagcaacgaactttat
gatctgccacgtcctactttggcaaaagtagtaaatattggaggactaggagttggattt
gacagtgctaagcctttaactggagagttcaaaacaatctcagaaactggaaaaggaatg
attgtattctcgtttggatcggtggcagcagcccatgaaatgcctttagaatggaaaaat
gcaattctcgatgcattctcatctcttccagattatcaatttgttatgagatatttggga
actgatctgaatgatagattaccgaaaaatgtacatttatccaaatggcttccgcaaaaa
gatcttcttcttcacaataaaacaaaggcatttatcagtcatggaggatataattctatg
caggaagcaatctctgctggagtaccacttgtcacaattgctcttttcggtgatcaacct
aaaaatgctcaaattgcgaaaaaacatggattcgctgttaatattcaaaaaggaacaatt
tcaaaagaaacgattgttgaggcgttgaaagaagtccttgaaaatgatagttacaaacaa
aaagtgagtcgtctctctgcaatggtccgtgcccaaccaatgaaaccagctgaacgtctt
ctaaaatggtcagaattcctcgccgaattcaaaactctagataatttggaaccagctgga
caaaaactcaatttcttccaataccactctcttgatgttattggctttcttttcactgtc
attttccttgttttctacattttctaccgtatcctccgtgctctagtcagatgctgttgt
tgtaggaagtcccacgaaaagaagaaaaccgaatag

DBGET integrated database retrieval system