KEGG   Caenorhabditis briggsae: CBG18047Help
Entry
CBG18047          CDS       T01054                                 

Gene name
Cbr-ugt-62
Definition
(RefSeq) C. briggsae CBR-UGT-62 protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00040  Pentose and glucuronate interconversions
cbr00053  Ascorbate and aldarate metabolism
cbr00830  Retinol metabolism
cbr00860  Porphyrin and chlorophyll metabolism
cbr00980  Metabolism of xenobiotics by cytochrome P450
cbr00982  Drug metabolism - cytochrome P450
cbr00983  Drug metabolism - other enzymes
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBG18047 (Cbr-ugt-62)
   00053 Ascorbate and aldarate metabolism
    CBG18047 (Cbr-ugt-62)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG18047 (Cbr-ugt-62)
   00860 Porphyrin and chlorophyll metabolism
    CBG18047 (Cbr-ugt-62)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG18047 (Cbr-ugt-62)
   00982 Drug metabolism - cytochrome P450
    CBG18047 (Cbr-ugt-62)
   00983 Drug metabolism - other enzymes
    CBG18047 (Cbr-ugt-62)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CBG18047 (Cbr-ugt-62)
Glycosyltransferases [BR:cbr01003]
 Others
  Hydrophobic molecule
   CBG18047 (Cbr-ugt-62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C DUF1980
Motif
Other DBs
NCBI-GeneID: 8584101
NCBI-ProteinID: XP_002642106
WormBase: CBG18047
UniProt: A8XSX1
Position
III
AA seq 531 aa AA seqDB search
MKIFALLSLLLGAVASYKYVIFVPNMANSQTQFCARVAEVLANGGHDVTMLFVTHLSDFK
TDVKIPKGVKSYHLDAFIEGITKESIEKEQSAMIFKDTGLKDMPAMMAMFGRFGKMLQEG
CRAVIRNKEFMKWLENEKFDVAYAYIYSTCPIGLIHTAKIPSWVWLNSGPLMDYVAETTG
VPIIPSYVPPVMMESHDLMGFVFRTKSFIGHFLMTLFHRKMSSDAETQIFREELNDPSFP
HTMDIGAKCPLIIVNSNELYDLPRPTLAKVVNIGGLGVGFDSAKPLTGEFKTISETGKGM
IVFSFGSVAAAHEMPLEWKNAILDAFSSLPDYQFVMRYLGTDLNDRLPKNVHLSKWLPQK
DLLLHNKTKAFISHGGYNSMQEAISAGVPLVTIALFGDQPKNAQIAKKHGFAVNIQKGTI
SKETIVEALKEVLENDSYKQKVSRLSAMVRAQPMKPAERLLKWSEFLAEFKTLDNLEPAG
QKLNFFQYHSLDVIGFLFTVIFLVFYIFYRILRALVRCCCCRKSHEKKKTE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgctctattatcattgctcctaggagcagtcgcctcctacaaatatgtt
atttttgtaccaaatatggctaatagtcagactcaattctgtgctcgtgtagcagaggtt
cttgccaatggaggtcacgatgtcactatgctcttcgtcactcatttatctgatttcaag
actgatgtgaaaattccaaagggagtcaaaagttaccatctcgatgctttcatagaggga
atcacaaaggaaagcattgagaaagagcaatctgctatgatattcaaagatactggactt
aaagatatgccagctatgatggcaatgttcggtcgctttggaaagatgctccaagaagga
tgtcgcgcagttattagaaacaaggaatttatgaagtggttggaaaatgaaaagtttgat
gttgcatacgcatacatctattctacttgtccaattggattaattcatacagccaagatt
ccatcttgggtttggttaaacagtggaccactcatggactacgttgctgaaacaactgga
gttccaatcattcctagttatgttccacctgtgatgatggaatctcacgatttaatggga
ttcgtttttagaacaaaaagctttattggacatttcttgatgactcttttccacagaaaa
atgtcttccgatgcggaaacgcagatttttcgtgaggaattgaacgatccatctttccca
catacaatggatattggagcaaaatgcccattgatcattgtaaacagcaacgaactttat
gatctgccacgtcctactttggcaaaagtagtaaatattggaggactaggagttggattt
gacagtgctaagcctttaactggagagttcaaaacaatctcagaaactggaaaaggaatg
attgtattctcgtttggatcggtggcagcagcccatgaaatgcctttagaatggaaaaat
gcaattctcgatgcattctcatctcttccagattatcaatttgttatgagatatttggga
actgatctgaatgatagattaccgaaaaatgtacatttatccaaatggcttccgcaaaaa
gatcttcttcttcacaataaaacaaaggcatttatcagtcatggaggatataattctatg
caggaagcaatctctgctggagtaccacttgtcacaattgctcttttcggtgatcaacct
aaaaatgctcaaattgcgaaaaaacatggattcgctgttaatattcaaaaaggaacaatt
tcaaaagaaacgattgttgaggcgttgaaagaagtccttgaaaatgatagttacaaacaa
aaagtgagtcgtctctctgcaatggtccgtgcccaaccaatgaaaccagctgaacgtctt
ctaaaatggtcagaattcctcgccgaattcaaaactctagataatttggaaccagctgga
caaaaactcaatttcttccaataccactctcttgatgttattggctttcttttcactgtc
attttccttgttttctacattttctaccgtatcctccgtgctctagtcagatgctgttgt
tgtaggaagtcccacgaaaagaagaaaaccgaatag

DBGET integrated database retrieval system