KEGG   Caenorhabditis briggsae: CBG18286Help
Entry
CBG18286          CDS       T01054                                 

Gene name
Cbr-lit-1
Definition
C. briggsae CBR-LIT-1 protein
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG18286 (Cbr-lit-1)
   04310 Wnt signaling pathway
    CBG18286 (Cbr-lit-1)
   04068 FoxO signaling pathway
    CBG18286 (Cbr-lit-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CBG18286 (Cbr-lit-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CBG18286 (Cbr-lit-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 435 aa AA seqDB search
MILVAIIESLIEYLRKFVWVAHVSSNAILAAAQPFYQPPVQDSQPDRPIGYGAFGVVWSV
TDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQEL
YVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSN
CILKICDFGLARTWDSRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELL
QRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQ
TTDDAVDLLVKLLKFNPDERISVEEALSHPYLEEGRLRFHSCMCSCCYTKANVPSRIFSQ
ELDPKHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASS
SVAQASELPPSPQAW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattctggtggcaatcattgaatctctaatcgaatatctacggaaattcgtttgggtg
gcacatgtctcttcaaatgccattctggcagccgcccaaccattctaccagcctccagta
caagattcccaaccagacaggcctattggctatggtgcttttggagttgtttggtcagtc
acagatcctcgaagtggaaagcgagtagcactgaagaagatgccaaatgtattccaaaac
ttggcttcgtgtaaacgagtatttcgagaaatcaagatgctctcctcgttccgacatgac
aatgttctttcactgctagacattttgcagccagcaaatccgagcttctttcaagaatta
tatgtgctcaccgagttaatgcaaagtgaccttcacaagataatcgtttccccacaaaca
ctgacaattgatcatgtcaaagtttttgtatatcagattctcagaggattgaaatatttg
catactgcaaacattctacatagagatatcaagccaggaaaccttttggtcaacagcaat
tgcattcttaaaatctgcgactttggattggcgcgaacatgggattcacgagaccgcctg
aacatgactcatgaagttgtcactcaatactacagagcaccagaacttttgatgggcgcc
aggaggtatacgggagccgttgacatctggtctgtcggatgcatcttcgctgagcttctg
caacgaaagatcctgttccaagccgctggaccgattgaacagcttcagatgatcattgat
cttcttggaacaccatcacaagaagcgatgaaatatgcttgcgagggagccaagaaccac
gtccttcgtgctggaccacgagctccgaatcttcagtccctatacagattgtctcaacag
acaacagacgatgcagtggatctgttagtgaaacttcttaaattcaatccagatgagaga
atcagcgtagaagaagcactttcacatccatatctcgaagaaggacgactccgtttccac
tcgtgtatgtgctcgtgctgttatacgaaagcaaacgtgccatcaaggatattttcgcaa
gaattagaccctaagcacgagagtccattcgatccaaaatgggagaaagacatgtcacgg
ctgtcaatgttcgaacttcgcgagaaaatgtaccaattcgtgatggatcgaccagccctc
tacggtgttgcattatgcataaatccgcagtcagcggcctacaagaatttcgcaagctca
tcagtagcgcaggcgtccgaattacccccctcaccacaggcgtggtga

DBGET integrated database retrieval system