KEGG   Caenorhabditis briggsae: CBG18286Help
Entry
CBG18286          CDS       T01054                                 

Gene name
Cbr-lit-1
Definition
C. briggsae CBR-LIT-1 protein
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cbr04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cbr04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 435 aa AA seqDB search
MILVAIIESLIEYLRKFVWVAHVSSNAILAAAQPFYQPPVQDSQPDRPIGYGAFGVVWSV
TDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQEL
YVLTELMQSDLHKIIVSPQTLTIDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSN
CILKICDFGLARTWDSRDRLNMTHEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELL
QRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGPRAPNLQSLYRLSQQ
TTDDAVDLLVKLLKFNPDERISVEEALSHPYLEEGRLRFHSCMCSCCYTKANVPSRIFSQ
ELDPKHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASS
SVAQASELPPSPQAW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattctggtggcaatcattgaatctctaatcgaatatctacggaaattcgtttgggtg
gcacatgtctcttcaaatgccattctggcagccgcccaaccattctaccagcctccagta
caagattcccaaccagacaggcctattggctatggtgcttttggagttgtttggtcagtc
acagatcctcgaagtggaaagcgagtagcactgaagaagatgccaaatgtattccaaaac
ttggcttcgtgtaaacgagtatttcgagaaatcaagatgctctcctcgttccgacatgac
aatgttctttcactgctagacattttgcagccagcaaatccgagcttctttcaagaatta
tatgtgctcaccgagttaatgcaaagtgaccttcacaagataatcgtttccccacaaaca
ctgacaattgatcatgtcaaagtttttgtatatcagattctcagaggattgaaatatttg
catactgcaaacattctacatagagatatcaagccaggaaaccttttggtcaacagcaat
tgcattcttaaaatctgcgactttggattggcgcgaacatgggattcacgagaccgcctg
aacatgactcatgaagttgtcactcaatactacagagcaccagaacttttgatgggcgcc
aggaggtatacgggagccgttgacatctggtctgtcggatgcatcttcgctgagcttctg
caacgaaagatcctgttccaagccgctggaccgattgaacagcttcagatgatcattgat
cttcttggaacaccatcacaagaagcgatgaaatatgcttgcgagggagccaagaaccac
gtccttcgtgctggaccacgagctccgaatcttcagtccctatacagattgtctcaacag
acaacagacgatgcagtggatctgttagtgaaacttcttaaattcaatccagatgagaga
atcagcgtagaagaagcactttcacatccatatctcgaagaaggacgactccgtttccac
tcgtgtatgtgctcgtgctgttatacgaaagcaaacgtgccatcaaggatattttcgcaa
gaattagaccctaagcacgagagtccattcgatccaaaatgggagaaagacatgtcacgg
ctgtcaatgttcgaacttcgcgagaaaatgtaccaattcgtgatggatcgaccagccctc
tacggtgttgcattatgcataaatccgcagtcagcggcctacaagaatttcgcaagctca
tcagtagcgcaggcgtccgaattacccccctcaccacaggcgtggtga

DBGET integrated database retrieval system