KEGG   Caenorhabditis briggsae: CBG18300Help
Entry
CBG18300          CDS       T01054                                 

Gene name
Cbr-hex-3
Definition
C. briggsae CBR-HEX-3 protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG18300 (Cbr-hex-3)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CBG18300 (Cbr-hex-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 620 aa AA seqDB search
MLRGFFGRRSRSAWVRLTYLCVITIIFLFASSQFKSTATHARFVPEVRQPAQPVHAIAVA
ADPRLRPNPESLNPNQDGIDQPDPARVDSPDVPQHQNAQWVTRKFLQQQRTSKKPFENVV
INGEKYPKLTPDGKFIPQRRIIHLDLKGAAYKPDYFEELFAFFNRLQATGILLEWEDMFP
FKGRLSSAVNKNAYSMETVERILKAAQKHHLQIIPLVQTMGHLEWILKLEQFAHLREDSR
FPQVICFSDDDAWDLIKEMIEDVAEVHKKFGMPYFHIGADEAFQIGICNASVARIQKEFS
RERLMLWHIARTARFVKEKYPETQVLAWHDMMASAMESDIEDYKLTELVQPVLWNYAEDL
DIYLPRSTWMLLRNFGSVWGSSAWKGADGPARYSTNANHYVKNHESWIKQLTMVYKDFNV
IEGLIMTGWSRYDHFAVLAETIPVALPTLAISMETMLEGRPLLGNHPITFELLQCSPPLD
LGYVASGCRFPGSRIYELINDMYQKQMQLRTYRQDDYEVNGWLSRVADEYTVSSHWYIDK
IEQMIEMHAVPLERIAEDLRFEMDKIFYKDTIDEFLFTYLGEDLEWLNKKRETIKKVSNA
KAFPKRPFVESAKSIGTQCS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggtttcttcgggcgccgatctcgttcggcatgggttcggctcacatatctc
tgcgttattacaataatatttctttttgcctcttcacagttcaagtcaacagctacacat
gcgagatttgtaccggaagtgagacaacccgctcagcctgtgcatgctattgctgtagct
gctgaccctcgactacgcccgaatccggaatctctgaatcccaaccaggatggaattgac
caaccagacccggctagagtggactctccggatgttcctcaacaccaaaatgcacaatgg
gttaccagaaaatttttgcaacaacagagaaccagcaaaaaaccatttgaaaatgttgta
atcaacggagagaagtatccaaagctgacacccgatggaaaattcatcccacaaaggcgg
ataattcatttggatctcaaaggcgctgcgtacaaacctgactatttcgaggaacttttc
gcatttttcaatcgacttcaagctactggaattcttttggaatgggaagatatgttcccg
tttaaaggacgactttctagtgctgttaataaaaatgcatacagtatggagactgtagaa
cgtattttgaaagcagctcaaaagcaccaccttcaaattatccccctggttcagactatg
ggtcatttggaatggattttgaagttggaacagtttgcacatctcagagaagactcacgg
ttcccacaagtcatttgcttttcggatgatgacgcatgggatcttataaaggagatgatt
gaagacgtggctgaagtccataagaagttcgggatgccttatttccatatcggtgcggac
gaagccttccagatcggtatctgtaatgcaagtgtcgctcgaatccaaaaagaattttct
cgcgaacgtctcatgctgtggcacatcgcaagaaccgctcgatttgtgaaagagaaatat
ccagaaacccaagttcttgcatggcatgacatgatggccagtgcaatggaatcagatatt
gaagattacaaattgacagagcttgttcagcctgttctgtggaactacgcagaagacctt
gatatttatctccccagatcgacgtggatgcttctcaggaatttcggaagtgtttgggga
agttctgcttggaaaggagccgatggtcctgcacgatattctacgaatgccaatcactat
gtgaagaatcacgagtcctggatcaaacagttaacaatggtctacaaggatttcaatgta
attgagggtcttataatgactggctggtctcgatatgatcacttcgctgttctcgctgaa
acaatcccagttgcgcttccaactcttgcaatcagtatggaaactatgcttgaaggtcgt
ccgctattaggaaatcatccaataacctttgagctgttgcaatgttcaccacctctcgat
cttggatacgtcgcatccggatgccgttttccaggaagtcgaatctacgaactgataaat
gatatgtatcaaaaacagatgcagcttcgaacatatcgacaagatgattatgaagttaac
ggatggttgtcgagggttgccgatgagtatactgtgtctagtcattggtacattgataaa
atcgaacaaatgatcgaaatgcacgccgtcccactcgagcgaatcgctgaagacctacga
tttgagatggataaaatattctacaaggataccatcgacgaattcctattcacctatctt
ggcgaggacctggaatggttgaacaaaaaacgtgagaccatcaaaaaagtatccaatgca
aaagcattcccgaaacgaccgtttgtcgagtcagccaaatctataggaactcaatgctcg
tag

DBGET integrated database retrieval system