KEGG   Caenorhabditis briggsae: CBG18393Help
Entry
CBG18393          CDS       T01054                                 

Gene name
Cbr-tag-235
Definition
C. briggsae CBR-TAG-235 protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CBG18393 (Cbr-tag-235)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 519 aa AA seqDB search
MPTRWWYFEKKAATRRERVAGNEEKVVNTFHRETADNKSAGARDCARARVAVWVRHLEVS
HRKESLACRFTECCRETIRIHLKLNISVCTASLFTSFLFFLPVRINSWMVMEDLTNVDRN
RKYISDGLQAVKMTFVQDINEMNTAPRYSPDMVYQHFGEEETIYGYADLEVTIHHSAQTL
YSYINICYSSKAKNDNGLEADDIEDKLVHIDVRPNVLVTEKGAFNQKLISQKNFQPYGEM
VHKFQSKGKNFEVYRVTEQSEDFNLFLERIQTLGMFFIECCSLTDNTEENWLHYFIYERC
DTGEGDGSTIAKVAGFATLYKFYNYFEKVRPRIAQMLLLPQYRKSGIGAQFMESFLRDLR
ATPEVFDVTVESPGDQFTFLRDYVDCINCMNLPEFSSENLKNGFSDKMRMAALDKLKISK
AQSRRVYEILRFRQTNKKDKEDLKAQRIDVKRRLYAPMKRSERDWKRLNLALTQEELRQA
ACGEMDEETKFSTLTQMYDRLMESYQKTIDRIEAHPKIF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgccaactcgctggtggtatttcgaaaaaaaagcggcaacgaggagggagagagtagcc
ggcaacgaagagaaagtggtgaacacattccaccgcgagacggctgacaacaagtccgca
ggtgcgagagactgcgcacgcgcgagagtcgcagtgtgggtgagacatttagaggtctcg
caccgaaaagagtcactcgcgtgtcgatttacggagtgttgccgcgaaacaatccgcatt
catttgaaattgaatatttctgtttgcactgcttctctcttcacatcttttttatttttt
ctgcctgtcaggataaatagttggatggtcatggaggatctcacgaacgtcgacaggaac
cgaaaatacatttcggatggcttgcaagctgtcaaaatgacttttgtgcaagacatcaac
gagatgaacaccgcacctcgctattctccggacatggtctatcaacacttcggtgaggaa
gaaacaatctatggatacgctgatttagaagtgacaattcaccactctgctcaaaccctc
tacagttatatcaacatttgttactcgagcaaagccaaaaacgacaacggacttgaagcg
gacgatattgaagataagctagtgcacatcgatgtcagacccaatgtgcttgttactgag
aaaggggcattcaatcagaagctgattagtcagaagaatttccagccatatggagagatg
gtgcacaagttccagagcaaaggaaaaaatttcgaagtctacagagtgactgagcaatcg
gaagactttaatttattcctcgaaagaatccagacacttggaatgttcttcattgagtgc
tgctcgcttaccgataacaccgaagagaactggcttcattatttcatatatgaaagatgc
gatacaggagaaggagacggaagtactattgcaaaagttgctggattcgccactctctac
aagttctacaactatttcgagaaagttcgtccacgcattgctcaaatgcttctgcttcca
caatacagaaaatccggaattggtgcacaattcatggaatccttccttcgcgatcttcgc
gccactccagaagtattcgatgtgactgtggaatcacctggagaccagttcaccttcctg
cgtgactacgtggattgcatcaattgcatgaatcttcctgaattctcttccgaaaatctc
aaaaatggattttccgacaaaatgcgcatggcagcgcttgacaagctgaagatctcgaaa
gcgcaatcgcggagagtttacgaaattcttcgtttccgccagacgaacaaaaaagacaag
gaagatttgaaagctcaaagaatcgacgttaaaagacgcctctacgcaccaatgaaaaga
tcggaacgcgattggaagcgtttgaatctggcgttgacccaggaggaacttcggcaagct
gcgtgtggggaaatggacgaggagaccaaattctcaactctcactcaaatgtatgacaga
ctcatggaatcctaccaaaagactattgatcgcatcgaagctcaccccaaaattttctaa

DBGET integrated database retrieval system