KEGG   Caenorhabditis briggsae: CBG18398Help
Entry
CBG18398          CDS       T01054                                 

Definition
Hypothetical protein CBG18398
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
cbr  Caenorhabditis briggsae
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    CBG18398
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     CBG18398
Glycosyltransferases [BR:cbr01003]
 Glycan extension
  Type 3 chain
   CBG18398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 389 aa AA seqDB search
MANWPRVSPIAYVALGVLLGLTLSIVSQSGNSAYDAASRIAIIRANRNDPQLEEHDHAHG
NDPHGDEEVDDHHANFAPVQFHSNDSSHSHDGESVIADEVAKKVRVFCWILTGKQNHEKR
AKHVKATWAKRCNKYVFMSSEEDAELPAINLNVSEGRDYLWAKTKGAFKYIYDHHLNDFD
WFLKADDDTYVVMENLRFMLLAHSPDEPIHFGCKFKPFTQGGYHSGGAGYVLSREALKKF
IEVALPDKSLCSQNHGGAEDAEMGKCLEKVGVKAGDSRDADGHHRFMPFVPEHHLSPGHV
DPKFWFWQYTYYPMDQGPTCCSDYAVSFHYVSPNLMYVLEYLIYHLKPFGIDRAIRVPKN
DTIIHTAYSISRSERGQDDAFRERPELPV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattggcctcgagtttctcccatcgcctacgtggcactcggcgtacttctcggc
ttgacactgtcgattgtctctcaatcgggaaattcagcctatgatgcagcatctcggata
gcaatcatcagagcgaatcgcaatgatccacaattggaagagcacgatcatgcacatgga
aatgatccgcacggcgacgaagaagtggacgatcatcatgccaacttcgcacccgttcaa
ttccattcgaacgactcatcacatagtcacgatggagagagtgtaatcgcagatgaggtg
gcaaagaaggttcgggtattctgttggattctcactggaaaacagaatcatgaaaaacga
gcgaaacatgtcaaagccacttgggcgaagagatgtaataaatacgtgttcatgtcatct
gaagaggacgcggaacttccagccatcaatttaaatgtatccgagggtcgagactattta
tgggcaaaaacgaaaggagcctttaaatacatctatgatcatcatttgaatgattttgat
tggttcctgaaagccgatgacgatacctatgtggttatggaaaatctcaggtttatgctt
ttggctcattctccggatgagccaattcatttcggatgcaaattcaaaccattcacacaa
ggaggttatcatagtggaggtgctggatatgtactgagtagagaggctcttaagaaattc
attgaagtggcacttcctgacaagtccttgtgctctcagaatcatggaggagccgaggat
gcagaaatgggaaaatgcttggaaaaagttggagtgaaggctggagattcaagagatgca
gatggacatcatagattcatgccatttgttccggaacatcatctatcacctggtcacgtg
gatccaaagttctggttctggcagtatacgtactatccaatggatcaaggaccgacatgt
tgctctgattatgccgtctccttccactacgtcagcccgaacttgatgtatgtgctcgag
tatctcatctaccatctgaaacctttcggtatcgatcgcgcaattcgtgtgcccaaaaac
gacaccatcatccatacggcatactcaatctctcggtctgaacgtggtcaagatgatgca
ttccgagagcgaccggagcttccagtctaa

DBGET integrated database retrieval system