KEGG   Caenorhabditis briggsae: CBG18401Help
Entry
CBG18401          CDS       T01054                                 

Gene name
Cbr-gsy-1
Definition
C. briggsae CBR-GSY-1 protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBG18401 (Cbr-gsy-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CBG18401 (Cbr-gsy-1)
Glycosyltransferases [BR:cbr01003]
 Polysaccharide
  Storage polysaccharide
   CBG18401 (Cbr-gsy-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 673 aa AA seqDB search
MPDHGRMPRNLSSNKIAKTIAGEDLDEEEVLEMDAGRSAREEGRFVFECAWEVANKVGGI
YTVLRSKAQISTEELGDQYCMFGPMKDGKWRLEVDPIEPENRTIRAAMKRFQADGFRCMY
GRWLIEGYPKVILFDLGSGAVKMNEWKHELFEKCKIGIPHEDIESNDAVILGFMVAIFLK
HFRESVTSYQPLVVAHFHEWQAGVGLLMTRLWKLDIATVYTTHATLLGRHLCAGGADLYN
NLDAFDLDAEAGKRKIYHQYCLERAACQTAHIFTTVSEITGLEAEHFLCRKPDILTPNGL
NVIKFAALHEFQNLHAQNKEKINQFIRGHFHGHLDFDLDKTLYFFTAGRYEFSNKGGDMF
IESLARLNHYLKTTNDPRHMGVTVVAFLIYPAPANSFNVESLKGQAVTKQLKEAVDRIKE
KVGQRIFDICLQGHLPEPEELMSPADNILLKRCIMSLHNSSLPPICTHNMIRADDPVLEA
LRRTALFNKPEDRVKVVFHPEFLSSVSPLIGLDYEDFVRGCHLGVFPSYYEPWGYTPAEC
TVMGIPSVSTNLSGFGCFMQEHVEDHEQKGIYVIDRRHKAAEESVQELANVMYDFCGQSR
RQRIILRNANEGLSALLDWQNLGVFYRDCRRLALERLHPDGVDKIIRENEGKVPSAATSR
RPSIHSSDGEDEE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccggaccatggacgtatgccgagaaatttgtcgtcgaataagatagccaaaacgatc
gctggcgaggatctggacgaggaggaggttctggagatggacgcgggacgaagcgctcgt
gaagagggtcgtttcgtcttcgagtgtgcatgggaagtggccaataaggtcggtggaatc
tacacggtgctccgcagcaaggctcaaatcagtaccgaggagctcggcgatcagtactgc
atgttcggaccgatgaaggatgggaaatggcgtttggaagtggacccgattgagcccgag
aatcgaacgattcgtgccgcgatgaagagatttcaggccgacggtttccggtgtatgtac
ggtcgatggctgatcgagggctatccgaaagtgattctattcgatttgggatccggcgcc
gttaagatgaacgaatggaagcacgagctgttcgagaagtgtaaaattggcattccccac
gaggacattgaatccaacgacgccgtgattctcggcttcatggttgccatcttcctcaaa
cacttccgtgaatccgtcaccagctatcaaccactcgtcgtagctcacttccacgaatgg
caggctggcgttggtcttctgatgactcgcctgtggaagctggacattgcgacggtgtac
acgacgcacgccacactgctcggacgtcatttgtgtgctggtggcgcggatttgtataac
aatttggatgcgttcgacttggatgcagaagcagggaagagaaagatctaccaccaatac
tgcctggaacgtgccgcgtgtcagaccgcgcacatcttcactacagtatccgaaatcacg
ggactcgaagccgagcacttcctctgccgaaaaccggacattctgacgccgaatggactg
aacgtcattaaattcgcggcgcttcacgaattccagaacttgcatgctcagaacaaggag
aagatcaatcagttcatccgcgggcacttccacggacatctggactttgatttggacaaa
acgctgtactttttcacggccggacgatacgagttctcgaataagggtggagatatgttc
attgagtcgttggcacgtctcaatcactatttgaagaccaccaacgatccgcgtcacatg
ggcgttacggtagtggccttcttgatctatccagcaccagccaattcgttcaacgtggaa
tccttaaagggacaggccgtcaccaagcagctcaaagaggcggtggaccggattaaggag
aaagttgggcagcgaatttttgacatttgtctgcagggacacttgccggagcccgaggag
ctaatgtcgccagctgataatattttgctgaaacgctgcatcatgtcgctgcacaactcg
agccttccaccaatctgcacgcacaacatgatccgtgccgacgacccggtcctcgaagcc
ctccgccgaaccgccctcttcaacaagcccgaggatcgtgtcaaagtggtcttccaccct
gaattcctctcctccgtctcgccactcatcggtctggattacgaggatttcgttcgtgga
tgccatttgggcgtcttcccatcgtactacgaaccatggggctacacaccggccgagtgt
accgtcatgggcatcccatcggtgtctacgaacctctctggcttcggatgtttcatgcag
gaacacgtcgaggatcatgagcagaagggaatctatgtgatcgatcggagacacaaggcc
gccgaggagtcggtgcaggagttggccaatgtcatgtacgacttttgtggacagtcacgt
cgtcaacgtatcattcttcgtaacgccaacgagggtctctcggcactgctcgattggcag
aatttgggggtgttctatcgcgattgccgccgattggcactggaacgccttcatcccgac
ggcgtcgacaagatcatcagagagaacgagggaaaagttccatcggccgccacgtcacgt
cgtccatcgattcattccagtgatggagaagacgaggagtaa

DBGET integrated database retrieval system