KEGG   Caenorhabditis briggsae: CBG18455Help
Entry
CBG18455          CDS       T01054                                 

Definition
Hypothetical protein CBG18455
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CBG18455
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CBG18455
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBG18455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 502 aa AA seqDB search
MVLLSAIDQGTSSSRFLVFEADTGELVTSHQIEVRQLFPAAGWVEMDPMEIYDTVISCIQ
KTIEKLENLGITADEIKSVGVANQRETSIVWDKTTGKPLYNAIVWLDTRTSGLADEAISR
TQSKSKDEFRQKTGLPIHPYFSALKLRWLFENVPEVKEAYKSGNLMFGTVDTWLIWKLTG
AYVTDVSNASRTLLLDLHKRKWSTELCEFFDLPMEILPEIKSSAEVYGYLKNGPLEGVPL
SGCLGDQQSAMVGHQCLNAGQSKNTYGTGTFMLCNIGTRPIISKNGLLTTVGFQFGADSP
VVYALEGSGSIGGNVVRFLRDNFKFIQDAKEMEGLCRKIQDTSGVYFVPSFTGLYTPYWD
STARGTILGLTQVSQREHICLAALRAVAFQSAEMVAAVEQDLDNGTKVTTLKVDGGMIAN
KLFNEIQADIMGVDIVTPKITEISGWGAAVAGGIGAQQISLDEFLEQSSEDNRYTPQKDE
QWRSKEMARWKEAVKRSCGWAT
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcctctcggcaatcgatcagggaacctcgtccagccgattcctggtttttgaa
gcggataccggagaattggtgaccagccatcagatcgaagtccgtcaactatttccggcg
gcaggatgggtggaaatggacccaatggaaatttacgataccgtaatctcgtgtattcaa
aaaactatcgagaaattggaaaacctgggaatcaccgccgatgagatcaagtcggtgggc
gtggccaatcagagagaaaccagcattgtttgggacaaaaccactggtaaaccactgtac
aatgcgatcgtttggttggataccagaacttctggattggcggatgaggcgatttccagg
acccagtcaaagtccaaagacgagttccgtcaaaaaaccggtctcccaatccatccatat
ttctccgcgttaaaactcagatggctcttcgaaaacgttccagaagtcaaggaagcctat
aaatctggaaatctcatgttcggaactgtcgacacctggctcatctggaaattaaccggc
gcttacgtcaccgacgtttcgaacgcctccaggacccttcttctagatctacacaagaga
aagtggtccaccgaactttgcgagttctttgatctaccgatggagattctccccgagatc
aagtcctctgccgaggtttatggataccttaaaaatggtcctttagaaggagtacccctc
tccggatgtctaggagatcagcaaagtgcaatggttggacatcagtgtctaaacgctggc
caatccaagaacacctatggtacaggcacttttatgttgtgcaatattggaacaagaccg
attatttcgaagaacggattgctgactactgtaggcttccagtttggagccgattctcct
gtggtatatgcgttagaaggttctggatccattggaggcaacgtggttagattcttgaga
gacaacttcaaatttatacaagatgcaaaggagatggaggggctttgtaggaagattcaa
gacacttctggtgtctacttcgtcccatccttcactggactctataccccgtactgggac
tcaacggcaagagggactatccttggccttactcaggtctctcaaagagagcacatctgt
ttggcagctcttcgcgctgtggcattccaaagtgctgaaatggtggctgctgttgagcag
gatctggataatgggacaaaagtgacgacgcttaaagtggatggtggaatgattgccaac
aaattgttcaatgagattcaggcggacattatgggtgtggatattgtgacaccgaagatt
acggagatttcgggatggggagcggcggtggctggtggtattggcgcacagcagattagt
ttggacgagttcttagagcagagtagtgaggacaatcgctataccccacaaaaggatgag
caatggcgatcgaaagaaatggctcgttggaaagaggccgttaagagatcctgcggatgg
gcgacataa

DBGET integrated database retrieval system