KEGG   Caenorhabditis briggsae: CBG18715Help
Entry
CBG18715          CDS       T01054                                 

Gene name
Cbr-plc-3
Definition
C. briggsae CBR-PLC-3 protein
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBG18715 (Cbr-plc-3)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    CBG18715 (Cbr-plc-3)
   04020 Calcium signaling pathway
    CBG18715 (Cbr-plc-3)
   04070 Phosphatidylinositol signaling system
    CBG18715 (Cbr-plc-3)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CBG18715 (Cbr-plc-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1302 aa AA seqDB search
MQHNSVGPSSSTRKTTVTNSPHTAGSIHLHHRSSNGFNTSRTPLNRHMEMDLGKMFSAME
KGHKVCKIAVLKKWDPAYKQLTLDRYSRQIFLTKLEQSAVRNKPTILDIRQIREVQTLYY
KLNTIKVDDKWKKDREIANFESKTILVISYGMAFALSNWILFVARKHMKPFVQTSLQFKV
QSDQLQQVTEDQMDFDQFSYASRQLIHVPELFSLRFGDLAEKHDRKGLVVTFQNFLRFLD
GKQFDDMASNRTRALEFLNRYFHEDQAYLGDRNEPSMTVLEFCDFLFSRENSLWDPTNEK
VTHDMSRPLSHYWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDCWDGQKKPGS
NEFLDIVIYHGYTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELK
DILGDYLLTQPANREEKQLPSPAALKKKIIVKHKKLPVESEDLAAVVKTDEFQDTEIIAR
ECVKKGILWMRNNNSHDWTSHVFILFPDRLCYLIETADPDNTSDDTVSVSGDEEREEETP
SGFGVKPEEMHVTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIGDFSLSILHD
GKVHHVRIRSKIVDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIACPQPQP
HLNQPWFSATADKEKAEELLSLIEEDGAFLIRTSSQDSSVFVLSLKVDGEFWHYRLKRDG
RIFVVNQKVFENLNQIVEFYANREFVRGISLRYPVNEKDISHLTAELAEARTPGCYMDLK
DLDKEVQARTLRPYRGTADDELSFPANVIITVLRKEEGLWRGRYGAMTGWFPSAHVQEIL
PEKTNASETSNYNTIELAGTLIERIHDFDKPHVIRISQSNQHWMSKQSYVLAANSSEEVE
GWQNHLFELTRSVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCS
FVEGKLDKLVEKGLLPFNSRKLSRVYPNGSRITSTNYSPVPMWNAGCHMVALNYQTGDKP
MQLNQGKFLANGRCGYLLKPDYMLTDDFDPASSEKCVTTAYPIRLNVQVIGGRHLSRRDK
NKGICSPFVEIEVIGMPCDTKVYQTKTIASNGLNPIWNQTFTFEIQCPEMALIRFHVEDG
DFVGPKTDPFIGQAVFPVDSIRCGFRSVPLKNQYSEELELSALLVDVQMCSREGSQLIRS
SSHFLQASRLAPVFAHRKITNGDSIPREMAPRLRTSATDRSLDSPTNSESRTTLLTSQRG
SQDSMDSAAETTSIASGTVSSQNGKMKKNWLKKFSFGKSSKS
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacaactctgtgggtccatcctcgtccacccgaaaaactacagtaaccaattct
ccccacaccgccggctccatccatctccatcatcggtcctcaaatggtttcaacacttca
cgaacgccactaaatcgccacatggaaatggacctgggaaaaatgttctcggctatggag
aaaggacataaagtctgtaaaattgccgtgttgaagaagtgggatccagcgtacaagcag
ttgacattagatcgatactctcgacagatctttttgacaaagttggagcagtcggcagtg
agaaacaagccaacaattttggatattcgacaaattcgagaagttcaaactttgtactac
aaactgaacactatcaaagtagacgataaatggaaaaaggaccgagaaattgcgaatttc
gagtcgaaaaccattttggtgatttcctatggcatggcgtttgcactatcgaattggatt
ttgtttgttgctcgaaagcacatgaaacccttcgtccaaacctccctgcaattcaaagtc
caatctgatcagctacaacaagtcactgaggatcaaatggatttcgatcaatttagctac
gccagtcgtcaactgatccacgttccagagctgttttcattgagattcggagatttggct
gaaaaacacgaccggaaaggattggtggtcacttttcagaactttttgcgatttttggac
ggcaaacagtttgacgacatggcatcaaatcgaacgagagctctggaattcttaaatcga
tattttcatgaggatcaagcgtatttgggagatagaaatgagccatcaatgacagttttg
gagttttgtgattttttgttttctcgcgagaactctttgtgggatccgacgaatgagaaa
gtgacgcatgatatgagcaggccgctgtctcattactggattgccagttcgcataataca
tatctcacgggtgatcaattacgatccgaatcatctctggattgttacgcacaggcgctg
ctcatgggatgcaggtgtattgagttagactgctgggatggtcaaaagaagccgggctct
aacgaattcttggatatcgtaatctatcacggctacacgatgacatcgaaaattctcctc
cgcgacgtcctccacgtcatcagacactacgcattcgtaaccagtgaatatccagtgata
ctgtcgattgaagacaattgctcagttccggctcaacgtcttctggctcaagaattaaag
gatattctgggagactatcttttgacacagccagcgaatcgagaagagaaacagctgcca
tcaccggcggcgttgaaaaagaaaatcattgtgaaacataagaaattgcctgtggagagt
gaagatttggcagctgtggtcaagactgatgagtttcaagacacggaaatcattgctcgc
gagtgtgtgaaaaaagggattctctggatgcgcaacaacaatagtcacgattggacctcc
cacgtcttcattttattccccgatcggctatgttacctgatagagaccgccgatccggat
aacacctcagatgatacggtatcagtgtctggagacgaagaacgagaagaggagacgcca
tctggatttggtgtgaagcctgaagagatgcatgtcactgaagaatggttccacggacgg
tgtgaacgagacgaagcgaaaaaacggattttggagcataaagagaagggaaatggtctt
tttatgattcgggattccaacctttttattggcgacttctctttatctattttacatgat
ggcaaagtgcaccatgtaaggattcggagcaagattgttgataaagaaaagaagtactac
ttcatggacaacaaagtgtgcgacaccctctacgagctggtctcctactacactcgtcac
tatctaacaactgcacatttcaaaatggtgctcacaatcgcttgtcctcaaccccaacca
catctcaatcaaccctggttctcagctacagccgataaggagaaggccgaggaattgctc
agcttaatcgaagaggatggtgctttcctgataagaacctcaagtcaggattcgtcggtt
ttcgtgttatcattaaaagtggacggggagttttggcattatcgattgaagcgggacgga
aggatttttgtggtgaatcagaaggtgttcgagaatctgaatcaaattgttgagttctac
gcgaatcgagaattcgttcgaggcatttcccttcgatatcctgtcaatgaaaaggatatt
tctcacctgacagcggagctggctgaagcgaggacacctggatgttatatggatttgaag
gatttggataaagaagttcaggcgagaacacttcgaccttatcgtggaaccgccgatgat
gagctctccttcccagcgaacgtgataattacagtactccggaaagaggaggggttgtgg
agagggagatatggagcgatgacaggatggttcccatcagcacatgttcaggagatattg
ccggagaagacaaatgcgtcggaaaccagcaactacaacactatcgaactagcagggaca
cttatcgaacgaatccatgactttgacaaaccacacgtgattcgaatatcacaatcgaat
cagcactggatgagtaagcagtcgtatgttttggcggcgaattcatccgaagaagtggaa
ggttggcagaaccatctcttcgagttgacccgatctgtgaacaccaaaatgagcattttg
aggaccaaagaaaaagaaaaacgaatcgccgccgagctctcaaatcttgttgtctactgt
caagcggtgccattcgaccccgcccacatttacaacgacgccttctacgaaatgtgtagt
tttgtggaaggcaaattggataaactagtagagaagggtctcttgccatttaattcaagg
aaactatcgagagtctacccgaatggatctaggataacttccactaactattcaccagtc
ccaatgtggaatgccggatgtcatatggtcgcgttgaactatcaaacgggcgacaaaccg
atgcaattgaatcagggcaagtttttggcaaacggacggtgtggatatttgctgaagccg
gattacatgctaactgatgattttgacccggcaagttctgaaaaatgcgtcacgacggct
tatccgatccggctcaatgtgcaagtgattggcggacgacatttatcgagaagagacaag
aataagggaatatgctcgccgtttgtggaaattgaggttattggaatgccatgtgataca
aaggtctatcagaccaagactattgcttccaacggtctaaatccaatttggaatcaaacg
ttcacattcgagatccagtgtccggaaatggcgctaattcgattccacgtcgaagatggg
gatttcgttggtccgaaaactgatccattcatcggacaagccgttttccctgtcgattcg
attcgttgtggtttccgatcggttcccctgaaaaatcaatattctgaagagctggagctg
tcggcgttgttggtggacgtgcaaatgtgttctagagaaggaagtcagttgattcgatct
tcgtcgcacttcttgcaggcgagccgtcttgctccagtgttcgctcatcgtaaaatcacc
aatggcgacagtatcccgcgagaaatggcaccgcggcttcggacatcggcaaccgatcga
tctttggactctccgacgaattctgaatcccgtacgacacttctgacgagtcaacgaggc
tcacaagattctatggatagtgctgcagaaaccacctccattgcatcaggaactgtcagc
tcgcaaaatggaaaaatgaagaaaaactggctcaaaaagttctccttcggcaaatccagc
aaatcctag

DBGET integrated database retrieval system