KEGG   Caenorhabditis briggsae: CBG18715Help
Entry
CBG18715          CDS       T01054                                 

Gene name
Cbr-plc-3
Definition
C. briggsae CBR-PLC-3 protein
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cbr00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:cbr04012]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cbr04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cbr04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
II
AA seq 1302 aa AA seqDB search
MQHNSVGPSSSTRKTTVTNSPHTAGSIHLHHRSSNGFNTSRTPLNRHMEMDLGKMFSAME
KGHKVCKIAVLKKWDPAYKQLTLDRYSRQIFLTKLEQSAVRNKPTILDIRQIREVQTLYY
KLNTIKVDDKWKKDREIANFESKTILVISYGMAFALSNWILFVARKHMKPFVQTSLQFKV
QSDQLQQVTEDQMDFDQFSYASRQLIHVPELFSLRFGDLAEKHDRKGLVVTFQNFLRFLD
GKQFDDMASNRTRALEFLNRYFHEDQAYLGDRNEPSMTVLEFCDFLFSRENSLWDPTNEK
VTHDMSRPLSHYWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDCWDGQKKPGS
NEFLDIVIYHGYTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELK
DILGDYLLTQPANREEKQLPSPAALKKKIIVKHKKLPVESEDLAAVVKTDEFQDTEIIAR
ECVKKGILWMRNNNSHDWTSHVFILFPDRLCYLIETADPDNTSDDTVSVSGDEEREEETP
SGFGVKPEEMHVTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIGDFSLSILHD
GKVHHVRIRSKIVDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIACPQPQP
HLNQPWFSATADKEKAEELLSLIEEDGAFLIRTSSQDSSVFVLSLKVDGEFWHYRLKRDG
RIFVVNQKVFENLNQIVEFYANREFVRGISLRYPVNEKDISHLTAELAEARTPGCYMDLK
DLDKEVQARTLRPYRGTADDELSFPANVIITVLRKEEGLWRGRYGAMTGWFPSAHVQEIL
PEKTNASETSNYNTIELAGTLIERIHDFDKPHVIRISQSNQHWMSKQSYVLAANSSEEVE
GWQNHLFELTRSVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCS
FVEGKLDKLVEKGLLPFNSRKLSRVYPNGSRITSTNYSPVPMWNAGCHMVALNYQTGDKP
MQLNQGKFLANGRCGYLLKPDYMLTDDFDPASSEKCVTTAYPIRLNVQVIGGRHLSRRDK
NKGICSPFVEIEVIGMPCDTKVYQTKTIASNGLNPIWNQTFTFEIQCPEMALIRFHVEDG
DFVGPKTDPFIGQAVFPVDSIRCGFRSVPLKNQYSEELELSALLVDVQMCSREGSQLIRS
SSHFLQASRLAPVFAHRKITNGDSIPREMAPRLRTSATDRSLDSPTNSESRTTLLTSQRG
SQDSMDSAAETTSIASGTVSSQNGKMKKNWLKKFSFGKSSKS
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacaactctgtgggtccatcctcgtccacccgaaaaactacagtaaccaattct
ccccacaccgccggctccatccatctccatcatcggtcctcaaatggtttcaacacttca
cgaacgccactaaatcgccacatggaaatggacctgggaaaaatgttctcggctatggag
aaaggacataaagtctgtaaaattgccgtgttgaagaagtgggatccagcgtacaagcag
ttgacattagatcgatactctcgacagatctttttgacaaagttggagcagtcggcagtg
agaaacaagccaacaattttggatattcgacaaattcgagaagttcaaactttgtactac
aaactgaacactatcaaagtagacgataaatggaaaaaggaccgagaaattgcgaatttc
gagtcgaaaaccattttggtgatttcctatggcatggcgtttgcactatcgaattggatt
ttgtttgttgctcgaaagcacatgaaacccttcgtccaaacctccctgcaattcaaagtc
caatctgatcagctacaacaagtcactgaggatcaaatggatttcgatcaatttagctac
gccagtcgtcaactgatccacgttccagagctgttttcattgagattcggagatttggct
gaaaaacacgaccggaaaggattggtggtcacttttcagaactttttgcgatttttggac
ggcaaacagtttgacgacatggcatcaaatcgaacgagagctctggaattcttaaatcga
tattttcatgaggatcaagcgtatttgggagatagaaatgagccatcaatgacagttttg
gagttttgtgattttttgttttctcgcgagaactctttgtgggatccgacgaatgagaaa
gtgacgcatgatatgagcaggccgctgtctcattactggattgccagttcgcataataca
tatctcacgggtgatcaattacgatccgaatcatctctggattgttacgcacaggcgctg
ctcatgggatgcaggtgtattgagttagactgctgggatggtcaaaagaagccgggctct
aacgaattcttggatatcgtaatctatcacggctacacgatgacatcgaaaattctcctc
cgcgacgtcctccacgtcatcagacactacgcattcgtaaccagtgaatatccagtgata
ctgtcgattgaagacaattgctcagttccggctcaacgtcttctggctcaagaattaaag
gatattctgggagactatcttttgacacagccagcgaatcgagaagagaaacagctgcca
tcaccggcggcgttgaaaaagaaaatcattgtgaaacataagaaattgcctgtggagagt
gaagatttggcagctgtggtcaagactgatgagtttcaagacacggaaatcattgctcgc
gagtgtgtgaaaaaagggattctctggatgcgcaacaacaatagtcacgattggacctcc
cacgtcttcattttattccccgatcggctatgttacctgatagagaccgccgatccggat
aacacctcagatgatacggtatcagtgtctggagacgaagaacgagaagaggagacgcca
tctggatttggtgtgaagcctgaagagatgcatgtcactgaagaatggttccacggacgg
tgtgaacgagacgaagcgaaaaaacggattttggagcataaagagaagggaaatggtctt
tttatgattcgggattccaacctttttattggcgacttctctttatctattttacatgat
ggcaaagtgcaccatgtaaggattcggagcaagattgttgataaagaaaagaagtactac
ttcatggacaacaaagtgtgcgacaccctctacgagctggtctcctactacactcgtcac
tatctaacaactgcacatttcaaaatggtgctcacaatcgcttgtcctcaaccccaacca
catctcaatcaaccctggttctcagctacagccgataaggagaaggccgaggaattgctc
agcttaatcgaagaggatggtgctttcctgataagaacctcaagtcaggattcgtcggtt
ttcgtgttatcattaaaagtggacggggagttttggcattatcgattgaagcgggacgga
aggatttttgtggtgaatcagaaggtgttcgagaatctgaatcaaattgttgagttctac
gcgaatcgagaattcgttcgaggcatttcccttcgatatcctgtcaatgaaaaggatatt
tctcacctgacagcggagctggctgaagcgaggacacctggatgttatatggatttgaag
gatttggataaagaagttcaggcgagaacacttcgaccttatcgtggaaccgccgatgat
gagctctccttcccagcgaacgtgataattacagtactccggaaagaggaggggttgtgg
agagggagatatggagcgatgacaggatggttcccatcagcacatgttcaggagatattg
ccggagaagacaaatgcgtcggaaaccagcaactacaacactatcgaactagcagggaca
cttatcgaacgaatccatgactttgacaaaccacacgtgattcgaatatcacaatcgaat
cagcactggatgagtaagcagtcgtatgttttggcggcgaattcatccgaagaagtggaa
ggttggcagaaccatctcttcgagttgacccgatctgtgaacaccaaaatgagcattttg
aggaccaaagaaaaagaaaaacgaatcgccgccgagctctcaaatcttgttgtctactgt
caagcggtgccattcgaccccgcccacatttacaacgacgccttctacgaaatgtgtagt
tttgtggaaggcaaattggataaactagtagagaagggtctcttgccatttaattcaagg
aaactatcgagagtctacccgaatggatctaggataacttccactaactattcaccagtc
ccaatgtggaatgccggatgtcatatggtcgcgttgaactatcaaacgggcgacaaaccg
atgcaattgaatcagggcaagtttttggcaaacggacggtgtggatatttgctgaagccg
gattacatgctaactgatgattttgacccggcaagttctgaaaaatgcgtcacgacggct
tatccgatccggctcaatgtgcaagtgattggcggacgacatttatcgagaagagacaag
aataagggaatatgctcgccgtttgtggaaattgaggttattggaatgccatgtgataca
aaggtctatcagaccaagactattgcttccaacggtctaaatccaatttggaatcaaacg
ttcacattcgagatccagtgtccggaaatggcgctaattcgattccacgtcgaagatggg
gatttcgttggtccgaaaactgatccattcatcggacaagccgttttccctgtcgattcg
attcgttgtggtttccgatcggttcccctgaaaaatcaatattctgaagagctggagctg
tcggcgttgttggtggacgtgcaaatgtgttctagagaaggaagtcagttgattcgatct
tcgtcgcacttcttgcaggcgagccgtcttgctccagtgttcgctcatcgtaaaatcacc
aatggcgacagtatcccgcgagaaatggcaccgcggcttcggacatcggcaaccgatcga
tctttggactctccgacgaattctgaatcccgtacgacacttctgacgagtcaacgaggc
tcacaagattctatggatagtgctgcagaaaccacctccattgcatcaggaactgtcagc
tcgcaaaatggaaaaatgaagaaaaactggctcaaaaagttctccttcggcaaatccagc
aaatcctag

DBGET integrated database retrieval system