KEGG   Caenorhabditis briggsae: CBG18825Help
Entry
CBG18825          CDS       T01054                                 

Definition
Hypothetical protein CBG18825
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 594 aa AA seqDB search
MSGKRRRLNTQGSSESSEKGGGGAKESSSQEENCEKRAKIDEKPESLMNLGAAAEADSEG
PTSSGAESGAPESTAPESSTKKEPEEVTVEPKSEPQALPELNKRYMVEKISPEKIENQVA
VILHMEMRPQVPRVLLNDDDEGKEDEQLQLMFYVHYEQLDRRNDEWIVLEQIKLNEPVKP
IAENEIIIPEELRQEGGLNNITTRSVRRQLEEHFHLQPNNSTMDATTARLEREHEERTKI
KNIPRITIGAYTINSWYYSPFPKFCENHEIFMCEYCLAYTPHKSRAKSHLQTCKLRQPPG
NEIYRKDNLSVYEVDGHTQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCETDSKGAH
IVGYFSREVESLNNLACIMIFPPFQKNGYGKLLIQLSYELSKREGYIGTPEKPLSDLGKV
SYRSYWWWVLIKQFKTHVGHTVTGTFLSHETGLAVPDIISTLSTMRLGKKYKDIAEPDFD
PNEWYCRLHPKILEHCLDHDYGKKPSLILDKSKVRWAPAVTRYEMERRRQKEQKKAGRRP
SKSSQANTPLATPTLDGGFGGFRERDKMDILYEINAGLTENRSFWLCDVDNELT
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaaaaggagacgactaaacacacaaggatcatcggaatcatctgaaaaagga
gggggcggagccaaagaatcatcatcacaagaagaaaattgtgaaaaacgggcgaaaatc
gacgaaaaaccggagagtttgatgaatttgggcgctgctgcagaagcggattctgaaggt
ccgacgtcttctggagcagaatctggagccccagaatccacggctccagaatcatcgacg
aaaaaagagccggaagaagtgaccgtggagccaaaatccgagccacaagcactgccggag
ctcaataaacgatatatggtggagaagatttcgccggagaaaattgaaaatcaagtcgcc
gtcatcctgcacatggaaatgcgtccacaagtgccacgtgtccttctgaatgacgatgac
gaggggaaagaggatgagcaattacagttgatgttctatgtgcattatgagcagctggat
aggagaaatgatgagtggattgtgctggaacaaatcaagctcaatgagccggtaaaaccg
atcgccgaaaatgagattatcattccggaagagctgcggcaagaagggggtttgaataat
atcacaacgagaagtgtccggcggcaattggaggagcattttcatttacaacccaataat
agtacaatggacgcgacgacggccaggctggagagagagcatgaggagcgcacaaaaatc
aagaacatcccgcggatcacgatcggcgcctacacgataaactcgtggtactactcgccg
ttccccaaattttgtgagaatcacgagatcttcatgtgcgagtactgtctggcctataca
ccacacaaatcccgggcaaaatcgcatttacagacatgcaaacttcgccagccgcccggg
aacgaaatctatcgaaaggacaatttatcggtttacgaagtggatggacatacgcaaaaa
ctctactgtcaatgcctttgtctcctttccaagctattcatggaccacaaaacgctgtac
tttgacgtcgacgatttcatgttttacgttctttgtgagaccgactcaaaaggagcccac
atcgttggatacttctcgcgagaggtggaatcgttgaacaatctcgcgtgcataatgatt
tttccgccgttccaaaagaatggatacggtaaactgttgattcagctcagctacgagcta
tcgaaacgcgagggctacattggaacaccggaaaaaccgctatcagacctcggaaaagtg
tcctaccgtagctattggtggtgggtgctgatcaaacagttcaaaacgcacgtcggacat
acggtaaccggcacatttttgtcgcatgagacaggtctagccgtgccggacatcatttcg
acactttcaacgatgcggttgggcaaaaagtataaagacatcgccgagccggatttcgac
ccgaacgaatggtactgtcgccttcatccgaaaattctggagcattgcctggatcacgac
tacggtaagaagccatcgctgatactggacaaatcgaaggtccgttgggcacccgccgtc
acccgatacgaaatggaacgacgccgtcagaaggagcagaagaaggccggaagacgaccg
tcgaaatcatcgcaagcgaacactccactggccacgcccactcttgatggtggctttggt
ggattccgggagagggataagatggatattctttatgaaatcaatgccggtttaactgaa
aataggagtttttggctttgtgatgtcgataatgaacttacttga

DBGET integrated database retrieval system