KEGG   Caenorhabditis briggsae: CBG18921Help
Entry
CBG18921          CDS       T01054                                 

Definition
Hypothetical protein CBG18921
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cbr  Caenorhabditis briggsae
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CBG18921
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CBG18921
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     CBG18921
    3.1.1.84  cocaine esterase
     CBG18921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 554 aa AA seqDB search
MGGFLSHLTPEENIEVVNATCGPVRGNVYKHNDVIVDGYLGIPYAKPPVGELRFKKPVPA
DTWTEPRDCFKYGPVCVQTGGFADIAGERSVTPEEAGCLTLNVFSPRAPSSEFKSGRPVM
VYIHGGGFELAGSSDFCAYSLSGTLPLKDVVVVTINYRLGVFGFLTTGDNACHGNMGLWD
QTLALKWVQKNIPSFGGDPNCVTVFGQSAGGASTDLLSLSPQSRDLFQRFIPMSGSAHCD
FAIRTAENQAQIFREFAQHHGFAGGDSEALFKWYKEQSVETLSNVKKFKKTPSGFLTFIP
NLDGDFFPKPLDELRREAPKKQMMIGVVEYEGLMLAMMNPAFAPPDEGLKIAPKGLYGKD
VVSNPEETQRLFYEKYTEGVDKSDENAMKKKLCEAIGDEFFNVGILQAAKSAAKHGNEVY
LYTFAYTNPEGFGMWDGMLPFKAAVHCTELRYLLGEGVYSKFDASEEDLKVVETTTTLFS
NFAKYGNPNGKGATSNEWEKYNLESPERHFHISYPLCEMRDVYHEGRIGFLEKLDGESDK
YQELIYGRKKSAKI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggaggatttttgtctcatttgactccagaggagaatattgaagtggtcaatgccaca
tgtggtccagtcagaggaaatgtttataaacataatgatgtcatcgtagatggttatctt
ggaataccgtatgccaagcctccggtaggagaacttcgtttcaagaaaccggtcccagct
gatacgtggacagagcccagagattgtttcaaatatggtccagtttgtgtccaaactgga
ggttttgcagacattgccggtgaaagatcagtcactcctgaagaagcgggatgtctaact
ttgaatgttttctctccaagagctccgtcttctgaattcaagtctggacgcccagtgatg
gtgtacatccatggtggaggttttgaactagctggctcatccgatttctgtgcatactca
ctctccggaacacttccactgaaagatgtcgttgttgtgaccatcaattatcgtctcgga
gttttcggattccttacaactggtgataacgcttgccatggaaacatgggtctttgggat
cagactctcgccctcaaatgggttcaaaagaacattccctcgtttggaggggatccaaat
tgtgttacagtttttggacaaagtgctggaggagccagtacggacttactttcattgagt
ccacagtctagagatcttttccaaagattcattccaatgtctggatcggcgcattgtgat
tttgctatcagaactgctgagaatcaagcacagatcttcagagaattcgcccagcatcat
ggatttgctggtggtgattcagaggctcttttcaagtggtacaaggaacaatctgttgaa
actttgagcaatgtgaagaagtttaagaagacaccttctggatttctgacatttattcca
aatttagatggagattttttcccaaaaccattggatgagttgagaagagaagcaccgaaa
aaacaaatgatgattggagttgtggaatatgagggactgatgttggctatgatgaatcca
gcttttgcaccacctgatgaaggtctgaaaattgctccaaaaggtctttacggcaaagat
gttgtcagtaatccagaagaaactcagagacttttctacgagaagtacacagaaggcgtt
gataaatccgatgaaaacgctatgaaaaagaaactttgtgaagctatcggagatgagttt
ttcaatgttggaattcttcaagctgcaaaatcagctgctaaacatggaaatgaagtgtat
ctgtatacatttgcctatacgaatcctgaaggtttcgggatgtgggatggcatgttgcct
ttcaaagcggctgttcactgcaccgaacttcgttatcttctcggagaaggcgtctattcg
aaattcgatgcatcggaagaggacctgaaagttgttgagactactaccacgctcttctcc
aattttgctaaatacggaaatcctaacggcaaaggagcaacatccaacgaatgggaaaaa
tacaacttggagagcccggaaagacatttccacatatcttatccactctgtgagatgaga
gatgtatatcacgagggaaggatcggattcctggagaaacttgatggagagagtgacaag
tatcaagaattgatttacggaaggaagaagtctgcgaaaatctga

DBGET integrated database retrieval system