KEGG   Caenorhabditis briggsae: CBG18935Help
Entry
CBG18935          CDS       T01054                                 

Definition
Hypothetical protein CBG18935
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBG18935
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CBG18935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 309 aa AA seqDB search
MVENNTLFVTGGVVVVSSIAIYLYLKTTKTCPFSACKKTSKRTLLDDSVKYSLPLIEKFE
ISHDTRKFRFGLPSKDHILGLPIGQHVYLSATIDGKLIVRPYTPVSSDEDKGFVDLMVKV
YFKNTNEKFPDGGKMSQYLESLKIGDTISFRGPQGNIVYKGQGLFSLKADKKSEPTNRSF
KHLSMIAGGTGITPMLQVIAAILRDPTDSTQIRLLFANQTEDDILCRQELDDLEAKHPDR
FRVWYTIDRPPAVWKYSSGFINDNMIKENLFPPGPDSAVLMCGPPPMINFACTPNLDKLE
YDPANRLLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaataacactctttttgtgactggaggtgtcgttgtggtctctagtattgca
atttacttgtacctgaagactacaaaaacctgtccgttttcagcatgtaaaaaaacttca
aaaagaacgcttctcgatgattcagtcaaatactcacttccattaatcgaaaagttcgag
atcagtcatgatacgagaaagttccgatttggacttccatccaaggatcacattcttgga
cttccaattggacaacacgtctacctcagtgctacgatcgatggaaagctcatcgttcgt
ccatatactccagtatccagtgacgaagacaagggattcgtcgatttgatggtcaaggtt
tatttcaagaataccaatgaaaagttcccagatggtgggaaaatgagtcaatacttggag
agcctcaagatcggagacacgatcagcttccgtggaccacaaggaaacattgtctacaag
ggacagggacttttcagtttgaaagccgacaaaaaatcggaaccaacaaatcgcagcttc
aaacatctgtccatgattgcgggaggaacaggaatcacacctatgcttcaagttatcgca
gcgattcttcgtgatccaaccgattccacacagatcagactcttattcgctaatcagaca
gaagatgatattctgtgtagacaagagctcgatgatttggaggctaagcatccagaccgc
ttccgtgtttggtatactatcgacagaccgccagcagtttggaagtattcctctggattc
atcaatgacaatatgatcaaggagaacctcttcccaccaggaccggattcggctgtcctg
atgtgcggcccaccaccaatgattaatttcgcctgcactccaaatctcgacaaactcgag
tatgatccagccaatcgtctccttttctag

DBGET integrated database retrieval system