KEGG   Caenorhabditis briggsae: CBG18953Help
Entry
CBG18953          CDS       T01054                                 

Gene name
Cbr-ubh-3
Definition
C. briggsae CBR-UBH-3 protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 227 aa AA seqDB search
MAPKGKGGWQALESNPETINPFLKKIGVSGLECVDVYSFDEEMLQFIPTPQLAMILCFPS
SEAREFLSKQYEEVEKNGKKPEGVFFMNQSEDIGNACGTFALFHSLGNLENRVNLGKGKF
AKWFAKAKLVKEDERSDLLSEDTDLAEAHDETAGEGDTEQTDNVDYHFITYVNKDGQLYE
IDSCAPFPRPLGSTSDASMIKDASVAIKELMNNVANLNFSAMALIGK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaaggaaaaggaggttggcaagcattggagtccaatcctgagacgatcaac
ccgttcctgaaaaaaatcggagtcagtgggttggaatgtgtcgatgtctactcattcgac
gaggagatgctccaattcattcccacaccacagctcgctatgattctttgcttcccaagt
tccgaagctcgtgaatttctctccaagcaatacgaagaggttgaaaagaatggaaagaag
ccggaaggtgtattcttcatgaaccaaagcgaagacatcggaaatgcatgtggcacattt
gctctatttcattcgctgggaaatcttgaaaatcgggtgaaccttggaaaaggaaaattt
gcgaaatggtttgcaaaggctaagctggttaaagaagacgaacgctccgatctgttgtct
gaagacactgatctagctgaagctcatgatgagacagcaggagaaggagacactgaacaa
accgacaatgtggactaccatttcattacatacgtcaacaaagatggtcagctttatgaa
attgactcttgtgctccattcccacgtccgcttggatctacatccgatgcgtcaatgatc
aaggatgcttccgttgctatcaaagagctcatgaataatgtcgccaatctcaatttttct
gccatggccctcattgggaagtaa

DBGET integrated database retrieval system