KEGG   Caenorhabditis briggsae: CBG18981Help
Entry
CBG18981          CDS       T01054                                 

Gene name
Cbr-ppt-1
Definition
C. briggsae CBR-PPT-1 protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cbr  Caenorhabditis briggsae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CBG18981 (Cbr-ppt-1)
  Lipid metabolism
   00062 Fatty acid elongation
    CBG18981 (Cbr-ppt-1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG18981 (Cbr-ppt-1)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CBG18981 (Cbr-ppt-1)
Lipid biosynthesis proteins [BR:cbr01004]
 Fatty acid synthase
  Component type
   CBG18981 (Cbr-ppt-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 306 aa AA seqDB search
MASTLLPFLLIFPLVFVTSTVADVRAGNGTKQVPVVMWHGMGDCCCNPLSMGSVKKLIEQ
EVPGVYVHSLELGGSITKDIEHGFFANVNELVYMACIKIKNDPELANGYNAIGFSQGAQF
LRAVAQRCPHPPMKNFVSIGGQQQGVFGAPYCIGDNVMCNSVRRLIDMGAYLPFVQKRVV
QAQYWHDPNQPDEYKKRSIFLADINNENKNNPTYKRNLLNLKNILLVKFNQDHMVVPKES
SWFGFYKDGDIDTILPMNETDLYLEDRIGLRKLHESGRLQFLAVDGDHLQIPRDVLVNEI
IKKYFM
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctagtacacttcttccctttctactgatattccctctagtatttgtcacttcaaca
gtggcagatgttcgagctggaaatggaacgaaacaggttccagttgttatgtggcatgga
atgggtgactgctgttgtaatccattatccatgggatcggtgaaaaaactgattgagcaa
gaagttccaggagtgtatgttcacagtctagaattgggtggaagtatcacaaaagatatc
gagcacggattttttgcaaatgtcaatgagctcgtttacatggcatgcatcaagattaaa
aacgatccagagctggcaaacggctacaatgctatcggattctcacaaggtgcacaattt
ctacgagccgttgctcaaagatgtccacatcctccaatgaagaactttgtatcaatcggg
ggtcaacaacaaggagttttcggagccccgtattgcatcggggataacgtaatgtgcaac
agtgtgagacgtctgattgatatgggagcatatcttccatttgttcagaaaagggttgtc
caagcgcagtattggcacgatccaaaccagccagatgagtacaaaaagagatcaatcttt
cttgccgacattaacaacgaaaataaaaacaatccgacctacaaacgaaatcttctgaat
ttgaaaaatatattactcgtgaagttcaatcaagatcacatggttgtaccaaaagaatca
tcgtggtttggtttctacaaggatggagacattgatacaattctcccaatgaatgagaca
gatttgtatcttgaagatagaatcggtctcagaaaacttcacgagagcggacgacttcaa
tttctggctgtcgacggagaccatcttcagattccaagagatgtccttgtcaacgaaatt
attaaaaaatattttatgtga

DBGET integrated database retrieval system