KEGG   Caenorhabditis briggsae: CBG18981Help
Entry
CBG18981          CDS       T01054                                 

Gene name
Cbr-ppt-1
Definition
C. briggsae CBR-PPT-1 protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cbr  Caenorhabditis briggsae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cbr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cbr00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cbr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 306 aa AA seqDB search
MASTLLPFLLIFPLVFVTSTVADVRAGNGTKQVPVVMWHGMGDCCCNPLSMGSVKKLIEQ
EVPGVYVHSLELGGSITKDIEHGFFANVNELVYMACIKIKNDPELANGYNAIGFSQGAQF
LRAVAQRCPHPPMKNFVSIGGQQQGVFGAPYCIGDNVMCNSVRRLIDMGAYLPFVQKRVV
QAQYWHDPNQPDEYKKRSIFLADINNENKNNPTYKRNLLNLKNILLVKFNQDHMVVPKES
SWFGFYKDGDIDTILPMNETDLYLEDRIGLRKLHESGRLQFLAVDGDHLQIPRDVLVNEI
IKKYFM
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctagtacacttcttccctttctactgatattccctctagtatttgtcacttcaaca
gtggcagatgttcgagctggaaatggaacgaaacaggttccagttgttatgtggcatgga
atgggtgactgctgttgtaatccattatccatgggatcggtgaaaaaactgattgagcaa
gaagttccaggagtgtatgttcacagtctagaattgggtggaagtatcacaaaagatatc
gagcacggattttttgcaaatgtcaatgagctcgtttacatggcatgcatcaagattaaa
aacgatccagagctggcaaacggctacaatgctatcggattctcacaaggtgcacaattt
ctacgagccgttgctcaaagatgtccacatcctccaatgaagaactttgtatcaatcggg
ggtcaacaacaaggagttttcggagccccgtattgcatcggggataacgtaatgtgcaac
agtgtgagacgtctgattgatatgggagcatatcttccatttgttcagaaaagggttgtc
caagcgcagtattggcacgatccaaaccagccagatgagtacaaaaagagatcaatcttt
cttgccgacattaacaacgaaaataaaaacaatccgacctacaaacgaaatcttctgaat
ttgaaaaatatattactcgtgaagttcaatcaagatcacatggttgtaccaaaagaatca
tcgtggtttggtttctacaaggatggagacattgatacaattctcccaatgaatgagaca
gatttgtatcttgaagatagaatcggtctcagaaaacttcacgagagcggacgacttcaa
tttctggctgtcgacggagaccatcttcagattccaagagatgtccttgtcaacgaaatt
attaaaaaatattttatgtga

DBGET integrated database retrieval system