KEGG   Caenorhabditis briggsae: CBG19001Help
Entry
CBG19001          CDS       T01054                                 

Definition
Hypothetical protein CBG19001
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbr  Caenorhabditis briggsae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBG19001
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBG19001
  Amino acid metabolism
   00310 Lysine degradation
    CBG19001
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CBG19001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 457 aa AA seqDB search
MLGRRAVSVHRFLSITARQGVTAASSVQPTLQAKASLLEPLVQNVRITSTANFHTSVIRM
SDVITVDGPAFAESISEGDIRWLKQKGDHVNEDELVAEIETDKTSVEVPAPQAGTIVELL
VEDGAKVTAKQKLYKLQPGAGGAKDESKSSASAAASPASVKNDPAPSSASSSSTASSPSS
PPPPPHKPAAGEIPKSAPPVARPPSTPSSSTPVGAVPVTRVTVPKGVDPSHAITGARDEV
RVKANRMRMRIAQRLKDAQNTYAMLTTFNEIDMSSLIEMRKTYQKEFVAKHGVKLGMMSP
FVRAAAYALQESPVVNAVLDENEIVYRHFVDISVAVATPKGLVVPVLRNVESMNYAQIEL
ELANLGVKAREGKLAVEDMEGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGPEIRPIM
QIALTYDHRLIDGREAVTFLKKIKTAVEDPRVMFMNL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctaggaagacgcgcagtatcagttcatcggttcctctcgataacagcgagacaaggt
gtcactgctgcttcatctgttcaaccaacacttcaagccaaagcaagtcttctggagcca
ctcgtccaaaatgtgagaatcacatctactgccaattttcacacaagtgttatcagaatg
agtgatgttatcaccgttgatggaccagctttcgccgagtctatttccgaaggagacatc
agatggctcaagcagaagggagatcatgtcaacgaagacgagctcgttgctgagatcgaa
actgacaagacctccgttgaagtgccagctccacaagctggaacaatcgtcgaattgttg
gttgaagatggagctaaggtcaccgctaagcaaaagctctacaaacttcagccaggagcc
ggaggagctaaggacgagtctaagtcttctgcttctgccgccgcttctccagcttctgtt
aagaacgatccagcaccttcatcggcttcctcatcatcaacggcttcctcaccatcaagc
ccaccaccaccaccacataagccagctgctggagaaattccaaagtccgctccaccagtc
gctcgtccaccatccactccatcttcatctactccagtaggtgccgttccagtcacccgt
gtcaccgttccaaagggagttgatccatcacacgcaatcacaggagcccgtgatgaggtt
cgtgtgaaggcgaacagaatgcgcatgcgtattgctcaaagactgaaggacgcccagaac
acatacgccatgcttaccactttcaacgagattgatatgagcagccttatcgagatgaga
aagacttatcaaaaggagttcgtcgctaagcatggagttaaactcggaatgatgtctcca
ttcgtccgcgctgccgcctatgctctccaagaatctccagttgtcaatgctgtccttgat
gaaaacgaaattgtataccgccactttgtcgatatttctgtcgctgttgctacaccaaaa
ggactcgttgttccagttttgagaaacgtcgaaagcatgaactatgctcaaatcgaactc
gagcttgcgaacctcggagtgaaggctcgtgaaggaaagttggctgttgaagacatggag
ggaggaacattcactatttcaaacggaggagttttcggatctatgttcggaacgccaatc
atcaacccaccacaaagtgccatccttggaatgcacggaccagagatccgaccaatcatg
caaatcgctttgacctatgaccacagattgattgatggaagagaggccgtcaccttcctc
aagaagatcaagaccgccgtcgaggatccaagggtcatgttcatgaacctttaa

DBGET integrated database retrieval system