KEGG   Caenorhabditis briggsae: CBG19001Help
Entry
CBG19001          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG19001
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00020  Citrate cycle (TCA cycle)
cbr00310  Lysine degradation
cbr01100  Metabolic pathways
cbr01200  Carbon metabolism
Module
cbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBG19001
  Amino acid metabolism
   00310 Lysine degradation
    CBG19001
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CBG19001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-GeneID: 8579307
NCBI-ProteinID: XP_002637312
WormBase: CBG19001
Position
V
AA seq 457 aa AA seqDB search
MLGRRAVSVHRFLSITARQGVTAASSVQPTLQAKASLLEPLVQNVRITSTANFHTSVIRM
SDVITVDGPAFAESISEGDIRWLKQKGDHVNEDELVAEIETDKTSVEVPAPQAGTIVELL
VEDGAKVTAKQKLYKLQPGAGGAKDESKSSASAAASPASVKNDPAPSSASSSSTASSPSS
PPPPPHKPAAGEIPKSAPPVARPPSTPSSSTPVGAVPVTRVTVPKGVDPSHAITGARDEV
RVKANRMRMRIAQRLKDAQNTYAMLTTFNEIDMSSLIEMRKTYQKEFVAKHGVKLGMMSP
FVRAAAYALQESPVVNAVLDENEIVYRHFVDISVAVATPKGLVVPVLRNVESMNYAQIEL
ELANLGVKAREGKLAVEDMEGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGPEIRPIM
QIALTYDHRLIDGREAVTFLKKIKTAVEDPRVMFMNL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctaggaagacgcgcagtatcagttcatcggttcctctcgataacagcgagacaaggt
gtcactgctgcttcatctgttcaaccaacacttcaagccaaagcaagtcttctggagcca
ctcgtccaaaatgtgagaatcacatctactgccaattttcacacaagtgttatcagaatg
agtgatgttatcaccgttgatggaccagctttcgccgagtctatttccgaaggagacatc
agatggctcaagcagaagggagatcatgtcaacgaagacgagctcgttgctgagatcgaa
actgacaagacctccgttgaagtgccagctccacaagctggaacaatcgtcgaattgttg
gttgaagatggagctaaggtcaccgctaagcaaaagctctacaaacttcagccaggagcc
ggaggagctaaggacgagtctaagtcttctgcttctgccgccgcttctccagcttctgtt
aagaacgatccagcaccttcatcggcttcctcatcatcaacggcttcctcaccatcaagc
ccaccaccaccaccacataagccagctgctggagaaattccaaagtccgctccaccagtc
gctcgtccaccatccactccatcttcatctactccagtaggtgccgttccagtcacccgt
gtcaccgttccaaagggagttgatccatcacacgcaatcacaggagcccgtgatgaggtt
cgtgtgaaggcgaacagaatgcgcatgcgtattgctcaaagactgaaggacgcccagaac
acatacgccatgcttaccactttcaacgagattgatatgagcagccttatcgagatgaga
aagacttatcaaaaggagttcgtcgctaagcatggagttaaactcggaatgatgtctcca
ttcgtccgcgctgccgcctatgctctccaagaatctccagttgtcaatgctgtccttgat
gaaaacgaaattgtataccgccactttgtcgatatttctgtcgctgttgctacaccaaaa
ggactcgttgttccagttttgagaaacgtcgaaagcatgaactatgctcaaatcgaactc
gagcttgcgaacctcggagtgaaggctcgtgaaggaaagttggctgttgaagacatggag
ggaggaacattcactatttcaaacggaggagttttcggatctatgttcggaacgccaatc
atcaacccaccacaaagtgccatccttggaatgcacggaccagagatccgaccaatcatg
caaatcgctttgacctatgaccacagattgattgatggaagagaggccgtcaccttcctc
aagaagatcaagaccgccgtcgaggatccaagggtcatgttcatgaacctttaa

DBGET integrated database retrieval system