KEGG   Caenorhabditis briggsae: CBG19077Help
Entry
CBG19077          CDS       T01054                                 

Gene name
Cbr-mys-1
Definition
C. briggsae CBR-MYS-1 protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 457 aa AA seqDB search
MTEPKIEIEEEINESPRTNGFDPSIYDKIVEGCRLSVRMASQNEWRQAEIISRCRAPNGS
MKFYVHYVDCNRRLDEWVQADMLDITTLRMPQKGGKKGAHLKEESRDSNETDAKRGGRKR
KIPLVPMDDVKQEPSDIAPPIPTVSNGSTPSLRGSMSMVGHSEDAMTRIRNVECIELGRS
RIQPWYFSPYPQQLTSLDCIYICEFCLKYLKSKTTLKRHMEKCALCHPPGNQIYSYDKLS
FFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVLTEEDEKGHHIVGYFSKEKE
SADEYNVACILVLPPFQKKGYGSLLIEFSYELSKIEQKTGSPEKPLSDLGLLSYRSYWSM
AIMKALFKFKRNRPTEDITVQDISQSTSIKREDVVSTLQQLDLYKYYKGQYVIVISDEKR
QVYEKRIEAAKKKTRINPNALQWRPKEYGKKRVSYHY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacccaaaatcgaaatagaagaagaaatcaacgaatcgccaaggacaaatgga
ttcgatccaagtatttatgataaaattgtcgaaggatgccggttaagtgtaagaatggct
tcacaaaatgaatggaggcaggcggaaattatttcaaggtgccgagctccaaatggctcg
atgaagttctacgtgcactatgtggactgtaaccgaagactggacgaatgggttcaagcc
gacatgctcgatatcacaacgctccgaatgccacaaaaaggtggaaagaaaggagcgcat
ttgaaggaagaaagtcgagattcaaacgaaacagatgctaaacgaggaggtcggaagcgg
aagataccactggtaccgatggatgacgtgaagcaagaaccatctgatatagcgccgccg
ataccaacagtgtcaaatggatcaacaccaagtcttcggggatcaatgtcaatggttggg
cacagtgaagatgcgatgacaaggatcagaaatgtcgaatgcatagagttgggaaggtcg
cgaatccagccgtggtacttctcaccctacccacaacagttgacgagtctggactgcatt
tatatttgtgaattctgtctcaaatatctcaagtcaaaaactactttaaaacggcacatg
gagaaatgcgcactgtgtcatccgcctggtaatcaaatatacagctacgacaaactctca
tttttcgaaatcgatggccggaagaacaagagttacgctcagaacttgtgcctccttgcc
aagctgtttctcgatcacaaaactctttactacgacactgatccctttttgttctatgtg
ctgacagaagaagatgaaaagggacatcacatagtgggatacttttcaaaagagaaagaa
tcggcagatgaatacaatgttgcatgcatattggtgttgccgccgttccagaaaaaggga
tatggcagtctgcttatcgaattcagctacgagttgtcgaaaatcgaacaaaagacagga
tcgccagaaaagccgctgtcggatctgggacttctctcttatcgatcgtactggtcgatg
gcaattatgaaggcactgttcaagttcaaacggaatcgccccaccgaggacataactgtc
caagatatctcgcaaagcacgtcaatcaagagagaagacgtcgtctcaacgttacaacag
cttgacttgtacaagtattacaaaggacagtacgtgatagtgataagtgacgagaagcgg
caagtttatgagaagcgaatagaagcagcaaagaaaaagacacgtattaatccaaatgca
ttacaatggcgaccgaaagaatacggaaagaaaagggtcagttaccactat

DBGET integrated database retrieval system