KEGG   Caenorhabditis briggsae: CBG19304Help
Entry
CBG19304          CDS       T01054                                 

Definition
Hypothetical protein CBG19304
Orthology
K11252  
histone H2B
Organism
cbr  Caenorhabditis briggsae
Brite
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG19304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 122 aa AA seqDB search
MAPPKPSAKGAKKAAKTQKPKTDKKRKHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMN
SFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaaagccatccgctaaaggagctaagaaggctgccaagacccagaagcca
aagactgacaagaagagaaagcatgccagaaaggaatcctactccgtctacatctaccgt
gtcctcaagcaggttcacccagatactggagtctcctcgaaggccatgtccatcatgaac
tccttcgtcaacgacgtcttcgagcgcatcgcctccgaagcttctcgtctcgcccactac
aacaaacgctccaccatctcatctcgtgaaatccagaccgccgtccgtctcatccttcca
ggagagcttgccaagcacgccgtctccgaaggaaccaaggctgtgaccaagtacacctcc
agcaagtaa

DBGET integrated database retrieval system