KEGG   Caenorhabditis briggsae: CBG19389Help
Entry
CBG19389          CDS       T01054                                 

Definition
Hypothetical protein CBG19389
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CBG19389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 1621 aa AA seqDB search
MVHPIKNIKVEMKIEPEDDYSYEEKEEERRKKNLEDLRACQLNMKRVGGVTDRHLLDLTK
EKTSRVQNQAYLEMMSQREGYGRDQGTSHEAPDVPFGNAPLSRSSFPVVATHSGPIMSSD
TRTRSRIKVEIKQEIDDIQDYLVSSTTQTPKPKAQKSKATAPKATPKNQKKKKKKEAEEE
DAYRPPHAWKNNTRYLYFAPAPARRSARLIKKEEDAIQKKLQGMKKEIVAQDLYPNLDVI
PSPPDFIPSPQSNELHEDLASAAINKQIDMFVATGEAMDPEDLNEIFAGSMSVSTTDHSK
PQSKREEHKNRDFNPATQQNTLPQDNRSEGDQQDQIMSTSSKRRNTNNSRCASLLQADPS
TSAAANTEDLDSDDDEMSSAGDPSEQAKRPRTPRGRYSPDASQKRAHSRMSALSIETSRN
TDLNADGSGPSSSSALSCALSTPDPDRLSSHKRRNAPPSSARSRKRRSPSVPMSQEEQSE
LDSDDEQDQSEMESLAIVTDDPTYKITPEHKSRFKEIKNNVSLDYEFNKGELAELYRSTK
AEQARLPEQIQFGNVIMKTWYGSPFPAEFINVKLLYICEFCFFFARSDQIMQNHAKKCTF
RAPPGVEIYRKEDISVFEVDGRIQKAYCQTLCLISRMFLESKTVFYDTEPFFFYIVTIND
EVGCRFAGYFSKEKYEPDVNNLSCIMTLPRYQEKGLGRFLIDVSYALSRKEGWNGGPEQP
LSDLGKKAYGGYWKTAIACSLVKFKDDIEFGDGISCGDIANDTGIHPHDVMLVVCGMQWG
KLMTPEGSKVSFIEWNIDWKDVHAIDEMKKKGHAMKIQFDEDYLDWVPRKMHPSMDGFHE
LSKEEIAEDEERRKSLQKTPTVDDSMDTATPTSLCMPTSSVKKELRSRGHNRNTIGRNLQ
LELRNNIKVPEGKEVTDDETKEDCMRKKKKKSFSRCEDNASAIEKRRDDSPDEDEQPGPS
SKPVARRHRGIRDFLEPAPSTSERKSGSSSGGHRKRTGDVKIDDSEDPTDDPVSSDDDDD
RPFGAVVASQKLKNGMARMAKKVSKKKKSVSGKKFPPNFGARQEKKEPSDKPEIPGPSEG
EDVLMEQGKEKQEKVKKSEDETTKDLNGEKLEDVGMATASEAEELHDDFHLNHMEEELPK
NYDIGTPESYHSTVSSRANTPQPQIMTQQVHFSVDESQFEDNDAAPPLLVSEVNNLSVSE
SAEPLDDGPSDAPPLVQSSSIPGGYSSEDDDAPPRLSPQYGKTDEEEMIPEPSTVEIEAP
AAPVQRQQSQHNGMHVDEPYRDPMSAGPSSSIQMTPQMMANGQPNMINTTPQLQHYSTPT
SQQQTTPGSGGIPSCGPVYSHSTPEQQQQFMSPQMAGMPASVSSVHSVHNSNSMEMVGGP
PSLQHTPQQQYDMGNSMGQMQPENGVMVNGMSQNMNSNMDQQNQMMMQQQQQHGFNSPTR
PAVVPQQPQQPPQQQQQPQQIPQQPPVPVPPAPAVTNGRRRSESGANAAGARKSRQRSTA
AAAPTVPPVVPAAQMPYNPMQMMQHMPVHGYFPYGYHAYPQMPENGFGYGYANAYGYPPV
FNPMPQMDPAVYQQRWQQMAAFNQGQVPADQNGAAAAAAAANYQFPPSAAGQMPYFQNNT
R
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atggttcatccaatcaagaacatcaaagtggagatgaaaatcgagccagaagatgactac
tcttacgaggagaaggaagaggaacggagaaagaaaaacttggaagatcttcgagcttgt
caattgaatatgaagagagtaggcggagttactgaccgccatttgctggatctgacaaaa
gaaaagacgtccagagtccaaaatcaagcatacttggaaatgatgtcccaaagagaagga
tatggtcgagatcaagggactagtcatgaagctccagacgttccgttcggcaatgctcca
ttgtctcgttcttcgtttcccgttgttgcaacacactccggaccaatcatgtcgtcagac
actagaacacgtagcagaatcaaagtcgaaataaaacaagaaatcgacgatattcaagat
tatttggtctcgagtacaactcagaccccaaagccaaaggctcagaagtccaaagcaaca
gctccaaaggcaacaccaaaaaatcaaaaaaaaaagaaaaaaaaagaagccgaggaggag
gatgcctacagacctcctcatgcatggaagaacaacacccggtatttatactttgctcca
gctccggcgagaagatctgcgagattgataaaaaaggaggaggatgcgatacagaagaaa
ctccaaggaatgaagaaggaaattgttgcccaagatttatatccaaatttggatgtcatc
ccgtctccacctgatttcatcccatctccgcaatcaaatgaactacatgaggatcttgct
tctgcagctatcaataaacagattgacatgtttgttgcgactggagaggcaatggatccg
gaggatttgaatgagattttcgctggttcgatgtcagtgagcactacagatcattcaaaa
cctcaatcaaaacgggaagaacacaaaaaccgggatttcaatcccgctacccagcaaaat
actctcccacaggataatcgctccgaaggcgaccagcaagatcagatcatgtcgacctca
tcgaaacgccgaaacaccaacaattcccgatgtgcgagcttactccaggcagatccttcg
acttcggcggcagcaaacaccgaagatctggactcagacgacgacgagatgtcgtcggcc
ggtgatccgtcggagcaggcgaagcgaccgcggacgcctagaggtcgttattctccagac
gcttctcagaagagagctcattcaagaatgagtgcgttgagcatagaaacaagccgaaac
accgacctaaatgctgatggatccggtccgagcagtagtagtgctctttcctgtgcactg
tcaacacccgacccagatcgactgtcttcgcataaaaggagaaatgctccaccatcatct
gctcgctcaaggaaacgacgaagtccatcggtaccgatgtcacaggaggaacagtctgag
ctcgattcagatgacgagcaagatcaatcagagatggaaagtctggctatagtgacagat
gatccaacttataagatcactcctgaacacaaatcgcggtttaaagaaatcaaaaataat
gtttcattagattacgagtttaataaaggagagctagctgagctataccgatcgacgaaa
gctgaacaagcacgactccccgagcagattcaattcggaaacgtcataatgaagacgtgg
tacggctcgccgttccctgccgagtttataaatgtgaagctgttgtacatctgcgaattc
tgctttttcttcgcccgatccgatcaaatcatgcagaatcatgcgaaaaagtgcacattt
cgagcaccacccggagtggaaatctatagaaaagaggatatttccgtgtttgaagtcgat
ggacgcattcaaaaagcctactgccaaacgttgtgtctgatttcccggatgtttctagag
agcaaaacagtgttctacgatactgaacccttcttcttctacattgtcacaatcaacgac
gaagtcggatgccgattcgccggctacttcagcaaagaaaaatacgagccggatgtaaat
aatttgtcatgtatcatgacacttcctaggtatcaagaaaaaggactcgggcgatttctg
atagatgtgagctacgcgttgtcacggaaagaaggctggaatggaggacccgagcaaccg
ctgtcagatcttggaaagaaggcgtacggtggatactggaaaacggcgattgcttgttcg
ctggtgaagttcaaggacgacattgagttcggtgatggaatcagttgtggagatatcgca
aatgacactggtattcatcctcatgacgttatgctagttgtgtgtgggatgcaatggggg
aagttaatgactccagaaggcagtaaagtcagtttcatcgaatggaatatcgactggaaa
gatgttcatgccattgatgagatgaagaagaagggacatgcaatgaagatacaatttgat
gaagactacctggattgggttccacgaaaaatgcacccatcgatggatggattccacgag
ttgtccaaagaggaaatagcagaggacgaagagagacggaagagtcttcagaagacacca
acagttgatgattcaatggacacagcgacgccaaccagcctctgcatgccgacaagctcc
gttaagaaagaactgagaagccgaggacacaatcgaaacacgatcggaagaaatcttcag
ctcgagttgaggaacaacatcaaagttccagaagggaaagaagtcaccgacgatgagacg
aaagaggattgcatgagaaagaagaagaaaaagagtttctcgcggtgtgaagacaatgcc
tctgccatagaaaaacgtcgtgatgactccccagacgaggatgagcaacctggaccttct
tccaagccagttgcgagacgtcatcgaggcattagagattttctagagccagctccctcg
acttctgaacgtaaaagcggttcctcatcaggagggcatcgcaaacgaactggagatgtc
aaaattgatgactccgaagatccgaccgacgacccagtatcttctgatgacgacgatgac
cgaccgtttggtgcagtggtggcaagccagaaattgaaaaatggaatggctcgaatggca
aagaaggtgtcgaagaaaaagaagtcagtttctggaaagaagtttcctccgaatttcgga
gctcggcaggagaagaaggaaccttcagacaagccagagattcctggcccgtccgaagga
gaagacgttttgatggagcaaggcaaagaaaaacaagagaaagtgaagaagtcggaagat
gaaaccacgaaagatttgaatggagagaaattagaagatgttggaatggcaacggctagt
gaagcagaggagttgcatgatgattttcatttgaatcatatggaggaggaattgccaaaa
aactacgacattggaacacccgaatcctaccactccacagtttcaagtcgtgccaacacg
ccgcaacctcaaataatgacccaacaagttcacttcagtgtagacgagagtcaatttgaa
gataacgatgctgcaccacctcttctggtttctgaagtcaacaacttgtcggtttcggaa
tccgcagaaccactcgacgatggaccatccgacgctccgccacttgttcagagctcttcg
attcccggaggatactcatcggaagacgatgatgctccaccaagactctcccctcaatat
ggaaagacggatgaagaagaaatgattccagaacccagcactgtagaaattgaagcccct
gctgctcctgtccaacgtcaacaatcgcaacacaacggaatgcacgtggatgaaccctat
cgtgatccaatgagtgctggaccgtcctcttctatccagatgacacctcaaatgatggca
aatgggcagccgaatatgattaatacaacgccccagctacaacactattccacaccaacc
tctcaacaacaaaccactccaggttctggtggcattccatcttgtggacctgtctacagc
catagcactcctgagcagcaacaacaattcatgagtcctcaaatggctggaatgccagca
tcggtctcttcagttcattctgtacacaatagcaactcgatggaaatggttggtgggcct
ccgtctcttcaacacactccacagcaacagtatgatatgggaaattccatgggacaaatg
cagccggaaaatggagtaatggtcaatggaatgtcgcagaatatgaattccaatatggat
cagcagaatcaaatgatgatgcaacaacagcaacaacacggattcaacagccccacacgt
cctgcggtggttcctcagcaaccacaacaacctcctcaacagcagcaacaacctcagcag
atccctcaacaaccccccgttcctgtgcctccagcacccgctgtcaccaacggtagacgt
cgttcagaatctggcgccaatgctgccggagctcgcaagtcacgtcaacgctcaacggcc
gccgctgctccaaccgttccaccagtggttcctgcagcacagatgccatacaatccgatg
cagatgatgcaacatatgccagtacacggatactttccttatggataccacgcctatcca
caaatgccagagaacgggtttggctacgggtacgccaatgcctatggatatccgccggta
ttcaatccgatgccccagatggatccagccgtttaccaacagagatggcaacaaatggct
gcgttcaatcaaggacaagtgccagcagatcagaatggtgctgcagcggcagccgcagcc
gcaaactatcagttccctcctagtgcagcaggccaaatgccatactttcaaaacaatact
cgttga

DBGET integrated database retrieval system