KEGG   Caenorhabditis briggsae: CBG19814Help
Entry
CBG19814          CDS       T01054                                 

Gene name
Cbr-kin-1
Definition
C. briggsae CBR-KIN-1 protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG19814 (Cbr-kin-1)
   04310 Wnt signaling pathway
    CBG19814 (Cbr-kin-1)
   04340 Hedgehog signaling pathway
    CBG19814 (Cbr-kin-1)
   04020 Calcium signaling pathway
    CBG19814 (Cbr-kin-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CBG19814 (Cbr-kin-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CBG19814 (Cbr-kin-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
I
AA seq 374 aa AA seqDB search
MLKFLKPKSSDEGSSKDNKSAASLKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGT
GSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFK
DNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPEN
LLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIK
NHKWFGSTDWIAIYQRKIKPPSFSNGEPKGRLFEALYARVDGPADTRHFVEEVQEPTQFV
IASTCQLPELFEDF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtttttaaagcccaaatcgtcagatgagggcagttcgaaggacaacaaatcg
gcggcgtcgctcaaagagttcctggacaaagcacgagaggacttcaaacaacgatgggag
aatccggctcagaacacggcgtgtctcgacgacttcgatcggataaaaacgctgggaacc
ggctcgtttggtcgtgtgatgcttgtcaaacataagcagtcgggcaactattatgccatg
aaaattctcgacaaacaaaaggtagtaaaacttaaacaagtggagcacacgctgaacgag
aagcgcatccttcaagccatcgattttccattcttggtcaacatgacattctcgttcaag
gacaactcaaatctgtacatggtattggaattcatctcgggaggagaaatgttctcccat
cttcgccgaatcggacgcttctcggaacctcattctcgcttctacgctgctcaaatcgtg
ttggcattcgagtacttgcactcgttggatctcatctatcgtgatttgaagccagagaat
ttgctcatcgactcgactggatatttgaagatcaccgactttggattcgcgaaacgcgtc
aaggggcgaacgtggacgttgtgcggaactccagaatacttggcaccggagattatcctt
tccaaaggatacaacaaggctgttgattggtgggcacttggcgtgttgatctacgaaatg
gctgccggatacccaccattcttcgccgatcaaccaattcagatcgagaaaatcgtgtca
ggaaaggtcaaattcccatctcacttctcaaacgagctcaaagacttgctcaagaacctg
ctccaagtggatttgacgaaacggtacggaaatctaaagaacggagtggccgacatcaaa
aatcacaaatggttcggatctaccgactggattgccatctatcagcgaaagatcaaaccg
ccctcattctccaacggagaacccaagggacggctattcgaagcgctgtatgcacgtgtc
gatggtccagctgacactcgacactttgtggaagaagttcaggaaccaacgcaattcgtg
atcgcatcgacgtgtcagctgccggagctgtttgaggatttctag

DBGET integrated database retrieval system