KEGG   Caenorhabditis briggsae: CBG19964Help
Entry
CBG19964          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG19964
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00511  Other glycan degradation
cbr00600  Sphingolipid metabolism
cbr01100  Metabolic pathways
cbr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG19964
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG19964
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG19964
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CBG19964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-GeneID: 8575897
NCBI-ProteinID: XP_002633901
WormBase: CBG19964
UniProt: A8XWU0
Position
IV
AA seq 519 aa AA seqDB search
MLKVSTFLFLFLGLAGFSGFESKSLPCSQVQKDHGIVCRCNATYCDTIEPLGTVTAGKAV
IYTTSKKGKRMDRTELKHSTSSNAKTKVYVNGTQTYQQIMGFGAAFTDAAGINMLTLPQA
MQDQIIQQYFSDDGLGYVFGRVPMASCDFSTHEYSYDDVAFDFQLTKFNLTMEDFQYKIP
FIKKAMAVSNGKLKLFATPWSSPAWMKTSGRMIGAGELIGDQNGKYYQTWAQYFVKFFEA
YHAQGIDFWSLTPQNEPTTGIDPFWKWQTLYFDASMERNFIKKLLGPALAANPVTKNMKI
MINDDQRINLPHWPKVILSDPMAAQYVNGIALHWYEDFIDPATVVTETHNLYPDYFILAT
EACAGYEPALGPKLGSWSRAEQYANDLIKDIGNWVAGWVDWNYMLDLQGGPNLVKNFVDA
TLIVNATAQEYYKQPIWHVMAQFSKFIKPGSTRIQTTIIEKSVDVEGLSFLNADGTKTVV
LLNKNEVLDFEVAVSDVLAPNVIYDLTIQANSLVTIVYK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtgtccacttttttatttttatttttgggattagctggattttccggattt
gaatcaaagtcgttgccatgctctcaagtacaaaaagaccatggaatcgtgtgtcgatgc
aacgccacctattgtgataccattgagcctctaggtacagtaaccgctgggaaagctgtt
atttatacaacttcgaagaaaggaaaacgaatggatagaaccgaattgaagcattcaacg
tcttctaatgcgaaaacgaaagtctacgtcaatggaactcaaacctaccaacaaatcatg
ggatttggtgctgcctttactgatgcagctggaatcaacatgctgactttgccacaagcg
atgcaggatcaaattattcagcagtatttttctgatgacggtcttggctacgtctttgga
agagttccaatggcttcttgcgatttttcaacccatgaatacagttatgacgatgttgca
tttgattttcagctcacgaaatttaacttgactatggaagatttccagtataagattcca
ttcatcaagaaggcaatggcagtttcgaacgggaaattgaagctgttcgcaacgccatgg
agctcgcctgcgtggatgaagacgtcgggacggatgattggagcaggagaattgattgga
gatcaaaatggaaaatattatcagacatgggcacagtattttgtcaaattcttcgaagcc
tatcacgcccaaggaattgacttctggtctctgacgcctcaaaatgagccaactacggga
atcgatccgttctggaagtggcaaactttgtactttgatgcttcaatggagcgtaatttt
atcaagaaactattgggaccagcattggctgccaatccagtcaccaagaatatgaaaatt
atgattaatgatgatcagagaatcaatttgccgcattggccgaaagttatcctctccgat
cccatggctgcacaatacgtcaatggaatcgcgctccattggtatgaagatttcatagat
cccgctaccgtagtcacagaaacccataatctctatccggattacttcatattggccact
gaagcatgcgctggatacgagccagccttgggaccgaagttaggatcatggtctagagct
gagcaatatgcaaatgatctgattaaagacattggaaactgggttgcaggatgggtcgac
tggaattatatgctcgatttgcaaggcggtccaaaccttgtcaaaaactttgtcgatgca
actctcatcgtaaatgctactgctcaagaatactacaaacaaccgatttggcatgttatg
gctcaattcagcaagtttatcaagccaggaagtactcggattcaaactactattatcgag
aaatctgttgatgtggagggtctctccttcctgaatgcagatggtaccaaaacggtggtt
ttgttgaataagaatgaggtactcgatttcgaggtagcagtaagtgatgtcttggcacca
aatgtcatctatgatttgacgattcaagccaattctttagtcactattgtgtataaatga

DBGET integrated database retrieval system