KEGG   Caenorhabditis briggsae: CBG20283Help
Entry
CBG20283          CDS       T01054                                 

Definition
Hypothetical protein CBG20283
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CBG20283
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG20283
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG20283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 790 aa AA seqDB search
MDVDAAIRTAMESGGFSVPAPNQKIFKEQCAFCFKDPHGPDGLYINLRNYHAFCKQHAVI
YANHTNYNLWVQFESTKVAVDEQRSDGEPTTKMTKLTIDAEPKYEFEDKYSVVIHPEYDN
KFSNVQGIPEIVDTIKTINESTSAERLALLTSTNNGWDNEIKLITRHANLEQSDEGKVLA
LSGWNCEVEDCGLSENLWLNLTDGAIRCGRSQFLANGEKTRGNGHMQDYYNATRFPLVVK
LGTISSNLESIDVFSYEEDDAVIDPNIVKHLMHFGLDPEKMEKTAKSTLEMELDMNEKWE
WARCTEDGAMLEPIFGPGYTGLINTGSSCYMNSVLQALIQVDSFRKRYSDQALQTMLKCP
IEMLHNDFNAQFAKVIHAMLSGDYSSEADPTHNHIKPLQFKRVAAGSHPEFSTAKQQDVE
EYIRFLFENVSKQNQNEDIDPTNSLRFQTWNRFEDNASGKVRYTEQEEIILRLPLPEGIM
KPTEKENHFTVDMTDAVQACFSKQFVEGYKSPITGEPKGANNTLSMKTFPDYLILQASKF
AYTMEGVQKKLDVEMEVSETLDLSAFRGHGKREDEELLPKDSAPPADAPPEIPANVRAVA
GDLMIMGFQENQSIRAAYFSNGNAEVATNWLMEHLEEPDIDAPFVMPTGTPSARGEIDPN
LVDSIVEMGFSRHQATYALKQVPTVAEAVEWLFTNLDSIPEESAAATGTSSDAPEASVTE
SASKKSFTDGSEKYQLIGIITHMGSRPDSGHYVAHMLKDGKWVLFNDEKVALSQDPPIKL
AYIYLYKRVD
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgatgctgccattcgcaccgccatggagtcgggcggcttctcggtgccggct
cctaatcagaagatcttcaaggagcaatgtgccttctgtttcaaagatccacacggacca
gacggcctctacatcaatctcagaaactatcacgccttctgcaaacagcacgctgtcatc
tatgctaaccatacgaattacaacctctgggtgcaattcgagtctactaaagtagctgtc
gatgaacagagaagcgatggagagccgacaaccaagatgaccaagctcacaatcgatgca
gagccgaaatacgagttcgaggacaaatactctgtggtgattcacccagaatatgacaat
aagttctccaacgttcaaggcattccagagattgtagatacaatcaagactatcaacgag
tccactagcgccgaacgtttggcccttctcacctccaccaacaacggatgggataatgaa
atcaaactgattacgagacatgctaatttggaacagagtgacgagggaaaggttctagcc
ttatctggatggaattgtgaagttgaggactgtggactctctgagaatctgtggcttaat
ttgaccgatggagcgattcgatgcggtcgaagccaatttcttgccaatggagagaagact
cgtggaaacggacatatgcaagactactacaatgccacacgattcccccttgttgtcaaa
ttgggaacaatttcttcgaatttggaatctatcgacgttttcagttatgaggaggacgac
gctgtgatcgatccaaatatagtgaaacatctgatgcatttcggtttggacccagagaaa
atggagaaaactgccaagagcacactggaaatggagttggatatgaatgaaaaatgggaa
tgggcacgttgtactgaggatggagcgatgttagagccaatcttcggtcccggctacact
ggactcattaacactggaagcagttgttatatgaactcggtccttcaagcactgattcaa
gtcgactcattccgcaaacgttacagcgatcaggctcttcaaacgatgctcaaatgccca
attgaaatgcttcacaatgatttcaacgcccagttcgcaaaggttatccatgcgatgctc
agtggagactactcttctgaagccgacccaacacacaaccacatcaaaccactgcaattc
aaaagagtcgctgctggaagtcacccagaattctctaccgctaaacaacaggatgtcgaa
gaatacattaggttcctctttgagaatgtctcgaaacaaaaccagaacgaagatattgac
ccaacgaattcattgagattccagacgtggaatcgctttgaagacaacgcatccggtaaa
gttagatacactgaacaggaagaaatcattcttcgcttgccacttccagagggtatcatg
aagccaaccgagaaagagaaccacttcacagtggatatgactgatgcagtccaagcatgc
ttctccaaacagtttgtcgaaggctataaatcgccaatcactggagagccaaaaggagca
aataacactctttccatgaagacgttccctgattatctcattctccaagcctcgaaattt
gcctataccatggaaggagtgcagaagaagcttgatgttgagatggaggtcagcgaaact
cttgatttgagcgcattccgtggacatggaaagcgagaggatgaggagttgctgccaaaa
gactcggcaccgccagccgatgctccaccagagatccctgccaacgttcgcgctgtagct
ggagatcttatgattatgggattccaagagaatcagagtatcagagcagcatacttctcc
aacggaaacgccgaggttgctacaaactggctgatggagcatttggaggagccagatatc
gatgcgccgtttgtcatgccaactggaacaccatcagctcgtggggagattgatccgaat
ctggtcgattcgattgtcgaaatgggattctcaaggcatcaggcgacctacgcattgaaa
caagttccaactgtcgctgaagctgtcgaatggcttttcaccaatttggatagtatcccc
gaagagtccgccgccgccactggaaccagctctgatgctccagaagcttcagtcaccgag
tcagcgagcaaaaagtcattcacagatggttccgagaagtatcaactgattggaatcatc
acccatatgggctctcgtcctgattctggccactatgttgctcatatgctgaaggacgga
aaatgggtgctcttcaacgacgagaaggttgctctttctcaggacccaccaatcaaattg
gcctacatttatctatacaaacgtgtcgattaa

DBGET integrated database retrieval system