KEGG   Caenorhabditis briggsae: CBG21017Help
Entry
CBG21017          CDS       T01054                                 

Gene name
Cbr-tpi-1
Definition
C. briggsae CBR-TPI-1 protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cbr00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
II
AA seq 247 aa AA seqDB search
MARKFFVGGNWKMNGDFASVDGIVAFLNQSADNSNVDVVVAPPAPYLAYAKANLKAGVLV
AAQNCYKTAKGAFTGEISPAMIKDLGLEWVILGHSERRHVFGESDALIAEKTVHALESGI
KVIFCIGEKLEEREAGHTKDVNFRQLQAIVDKGVSWENIVIAYEPVWAIGTGKTASPEQA
QEVHEWIRAFLKEKVSPAVADATRIIYGGSVTADNAAELGKKPDIDGFLVGGASLKPDFV
KIINARS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggaggaaactggaagatgaacggcgatttcgcctccgtc
gatggaatcgtcgctttcctcaaccaatccgccgacaactccaacgtcgacgtcgtagtc
gcgccaccagctccatacttggcgtatgccaaagccaacttgaaggctggagtgctcgtt
gctgcccagaactgctacaagacagcaaaaggagcattcaccggagagatctcgccagcc
atgattaaggatctcggattggaatgggtcatccttggccattctgagcgtcgccacgtc
ttcggggagagtgatgccctgatcgccgagaagactgtccacgctcttgagtctggaatc
aaggttatcttctgcattggagagaaactcgaggagcgtgaagctggacacacaaaggac
gtgaatttccgtcagctccaagccatcgttgataagggagtcagctgggaaaatatcgtg
atcgcctacgaaccagtgtgggccatcggaaccggaaagactgcatcgccggagcaagct
caagaggtccatgaatggatccgtgcgttcctcaaagagaaggtctctccagccgtggcg
gatgccacccgcattatctacggaggatccgtgactgccgataacgccgcagagctcgga
aagaagccagacattgacggtttcctggtcggtggagcctcgttgaagcctgatttcgtc
aagatcatcaacgccagatcttaa

DBGET integrated database retrieval system