KEGG   Caenorhabditis briggsae: CBG21043Help
Entry
CBG21043          CDS       T01054                                 

Definition
Hypothetical protein CBG21043
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG21043
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   CBG21043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 437 aa AA seqDB search
MTILPVKKKREKDAAQKSSSASGSSGDQNRGHHHHHHHQSIVGSSSGAKRNHQRIPQQQD
DGPYSKRLPPTAAAPSATVTQNNSENVDLAAKCRRNGSSNGNGDYNSDDEYREEHQRDDA
LEADFADRLARRGLIIKEMEGDGACMFRAIAEQIYGDQEMHGQIRQLCMDYMLRNRDHFR
EFITENYENYIERKRADHVHGNHVELQAISEMFARPVEVYQYSDEPINVLMPRPDAEVIP
PVGGPNEVGGANAEGGGASAAPPQQNPPLRLSYHRAVHYNAILDPKVPTIGVGLGLPGMV
PGAADKDLMTKAMAKSELEHIEETMLQDKMDLTDYQRTQADLEDQIARESLLTYLKDLES
KSGPSTSQQSTSSGGGGEVGGASTGGGSLYEEMLAAQSLEWDTYAYSDDVPIAEALLVSQ
QDFLAKNSQQPGPSGSK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttgccagtgaaaaagaagcgagaaaaggacgcggcgcagaagagtagctca
gcatctggaagttctggcgatcaaaatcgtggccaccatcaccatcaccatcatcaatcg
attgttggcagctcgtctggcgcgaaacggaatcatcagcgaattccacagcagcaggac
gatggaccatacagcaagagattacccccaaccgccgccgccccatcagctacagtaacc
cagaacaactcggaaaacgtggatttggcggcgaaatgccgtcgaaacgggtcgagcaac
gggaatggagactacaattcggatgacgagtatcgggaggagcatcagagagatgacgcg
ctggaagccgatttcgccgaccgtctcgcccgtcgcggcctcatcatcaaggagatggag
ggcgacggcgcgtgcatgtttcgagcgatcgctgagcagatctatggggatcaggagatg
cacggacagattcggcagctgtgtatggactatatgctcaggaatagggaccatttcaga
gagttcatcacggagaactacgagaactacatagagaggaaacgggcggaccatgtgcac
gggaatcacgtcgagttgcaggccatttccgagatgttcgcgcggccggtggaggtttat
cagtacagtgatgagcccataaacgtattgatgccacgtcccgacgctgaagtcatccct
ccagtgggcggacccaatgaagtgggcggagccaatgcggaagggggcggagcctcggct
gccccaccacaacagaatccgccacttcgtctgagctaccaccgggcggtgcactataat
gctatcctcgatccgaaggtgccaacgattggcgtgggcctaggcctgcctggaatggtc
cccggcgcagctgataaggatttgatgacgaaagcgatggccaagtcggaattggagcat
atcgaggagaccatgttacaggacaaaatggatttgacggattatcaacgaacgcaagcg
gacctggaagatcaaatcgctcgcgaatcactgttgacgtatttgaaggatttggaatcc
aagagtggaccatccacaagtcagcaatccacgtcatcaggaggcggcggagaagtgggc
ggagcttcgactggcggaggcagtttgtatgaggaaatgttggccgcgcagagtttggaa
tgggacacgtacgcctactctgatgacgtgccgatcgccgaagcgcttctcgtcagtcaa
caggattttctagcgaaaaactcccagcaaccgggaccatctggatcgaaataa

DBGET integrated database retrieval system