KEGG   Caenorhabditis briggsae: CBG21043Help
Entry
CBG21043          CDS       T01054                                 

Definition
Hypothetical protein CBG21043
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
cbr  Caenorhabditis briggsae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 437 aa AA seqDB search
MTILPVKKKREKDAAQKSSSASGSSGDQNRGHHHHHHHQSIVGSSSGAKRNHQRIPQQQD
DGPYSKRLPPTAAAPSATVTQNNSENVDLAAKCRRNGSSNGNGDYNSDDEYREEHQRDDA
LEADFADRLARRGLIIKEMEGDGACMFRAIAEQIYGDQEMHGQIRQLCMDYMLRNRDHFR
EFITENYENYIERKRADHVHGNHVELQAISEMFARPVEVYQYSDEPINVLMPRPDAEVIP
PVGGPNEVGGANAEGGGASAAPPQQNPPLRLSYHRAVHYNAILDPKVPTIGVGLGLPGMV
PGAADKDLMTKAMAKSELEHIEETMLQDKMDLTDYQRTQADLEDQIARESLLTYLKDLES
KSGPSTSQQSTSSGGGGEVGGASTGGGSLYEEMLAAQSLEWDTYAYSDDVPIAEALLVSQ
QDFLAKNSQQPGPSGSK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttgccagtgaaaaagaagcgagaaaaggacgcggcgcagaagagtagctca
gcatctggaagttctggcgatcaaaatcgtggccaccatcaccatcaccatcatcaatcg
attgttggcagctcgtctggcgcgaaacggaatcatcagcgaattccacagcagcaggac
gatggaccatacagcaagagattacccccaaccgccgccgccccatcagctacagtaacc
cagaacaactcggaaaacgtggatttggcggcgaaatgccgtcgaaacgggtcgagcaac
gggaatggagactacaattcggatgacgagtatcgggaggagcatcagagagatgacgcg
ctggaagccgatttcgccgaccgtctcgcccgtcgcggcctcatcatcaaggagatggag
ggcgacggcgcgtgcatgtttcgagcgatcgctgagcagatctatggggatcaggagatg
cacggacagattcggcagctgtgtatggactatatgctcaggaatagggaccatttcaga
gagttcatcacggagaactacgagaactacatagagaggaaacgggcggaccatgtgcac
gggaatcacgtcgagttgcaggccatttccgagatgttcgcgcggccggtggaggtttat
cagtacagtgatgagcccataaacgtattgatgccacgtcccgacgctgaagtcatccct
ccagtgggcggacccaatgaagtgggcggagccaatgcggaagggggcggagcctcggct
gccccaccacaacagaatccgccacttcgtctgagctaccaccgggcggtgcactataat
gctatcctcgatccgaaggtgccaacgattggcgtgggcctaggcctgcctggaatggtc
cccggcgcagctgataaggatttgatgacgaaagcgatggccaagtcggaattggagcat
atcgaggagaccatgttacaggacaaaatggatttgacggattatcaacgaacgcaagcg
gacctggaagatcaaatcgctcgcgaatcactgttgacgtatttgaaggatttggaatcc
aagagtggaccatccacaagtcagcaatccacgtcatcaggaggcggcggagaagtgggc
ggagcttcgactggcggaggcagtttgtatgaggaaatgttggccgcgcagagtttggaa
tgggacacgtacgcctactctgatgacgtgccgatcgccgaagcgcttctcgtcagtcaa
caggattttctagcgaaaaactcccagcaaccgggaccatctggatcgaaataa

DBGET integrated database retrieval system