KEGG   Caenorhabditis briggsae: CBG21103Help
Entry
CBG21103          CDS       T01054                                 

Gene name
Cbr-efk-1
Definition
C. briggsae CBR-EFK-1 protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     CBG21103 (Cbr-efk-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   CBG21103 (Cbr-efk-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 699 aa AA seqDB search
MTIDTTNESDTSPDRSPGFQTSARSFSLNASKMVPITDDYKDEDLVFIENNELVVEKPRM
DPLKVRQLMETWRRAARRARSNYVDPWDEFNIHEYPEQKARRYRYSAIRKQWTEDIVDVR
IHPDSFARGAMRECYRLKKCSVHGTTRDWSSNYVAKRYICQVDRRVLFDDVRLQMDAKLW
AEEFNRYNPPKKIDIVQMCVIELIDVIGSPLYHLEHFIEGKYIKYNSNSGFVSNAARLTP
QAFSHFTFERSGHQMMVVDIQGVGDLYTDPQIHTVVGTDYGDGNLGTRGMALFFHSHRCN
DICETMDLSNFELSPPEIEATEHAIAQAARQKKSCVAAPTVFEARRNRVSSECVHVVEHG
ISMDQLRKRKTLGYSSTDLSIKVHNEDCVCPECIPVVEQLCEPCSDDDSEDDDEEEVPAN
ILSLQLQQLARENAEANDEDPMPQVTGHQFSVLGQIHIDLARYHELGRFIELDSEQKEML
DGSENDSRLPIKYDKQSAIFHLDIARKCGILEAVLTSAHIVLGLPHELLKEVTVDDLFPE
GLGEQENGIRGRRKMHQLSYYLEEFGSDLMEIAAEMGDKGAMLYMAHAYETGQRLGPNRS
TDYKKSIDWYQRVVGFQDDEQPEQDSTNSGKSAFSSFSPLSRHEILAKMAEMYKEGGYGL
NRDFERAYCLFNEAAEAAMEAMNGKLANKYYEKAEMCGE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgacaccacaaatgagagcgatacatcgccagatcgctcgccgggatttcag
acatccgcccgttcgttctccctgaatgcgtcaaaaatggtgccaatcactgacgactac
aaggacgaagacctcgttttcattgagaataacgaactggtcgttgagaagccacgaatg
gacccgttgaaagtgcgtcaactgatggaaacgtggcgacgagcggctcggcgagcccgt
tcgaactatgtcgatccatgggacgagttcaacatccacgagtatcccgaacagaaagcc
cgtcgttatcgatattcggcgattcgaaaacagtggacggaggatattgtcgacgtcaga
atacatccggattcatttgctcgcggagcaatgagggagtgttatcgattgaagaagtgc
tcagtgcatgggaccacacgagattggagcagtaattatgtggcaaaacggtatatatgt
caggtggatcgacgcgttctttttgatgatgttcgacttcagatggacgccaaactgtgg
gccgaggaattcaatcgatacaatccgccgaaaaagattgacatcgttcaaatgtgtgta
atcgaactaatcgatgtgattggatcaccattatatcatttggagcatttcatcgaggga
aaatatattaaatataactcgaattctggattcgtctcaaatgcagcgagattgacacca
caagcgttctcacatttcacttttgaacggtccggacatcaaatgatggttgttgatatt
cagggtgtcggtgacctgtacactgatccccaaatacatacagtagtcggaacggattac
ggtgatggaaatctgggcacccggggaatggcccttttctttcactcgcatagatgtaac
gatatttgtgaaacaatggatttatcgaatttcgaactatcaccaccggaaatcgaagcg
acggagcatgcgattgctcaggctgctcggcagaagaagtcgtgtgtcgcggcacctaca
gtattcgaagcacgcagaaatcgagtgtcttctgagtgtgttcatgtcgttgagcacgga
atttcaatggatcagctgagaaagaggaagacgctgggatatagttccactgatttgtct
attaaggtgcacaacgaggactgcgtgtgtccggaatgcattccagtcgttgagcaactc
tgtgaaccatgctccgacgatgattcagaagacgatgacgaagaagaagtgccagcgaac
atcttatcacttcaattacaacagctggcaagggagaatgcagaagcgaacgatgaggat
ccgatgcctcaggtgacaggccatcagttctcggtcctcggacagatacacatcgatttg
gcacgttatcacgagctagggagattcattgaactggattcggagcaaaaagagatgctc
gatggatcggaaaatgactccagactcccgattaaatatgataagcaatcagcgattttc
catttggatatcgctagaaaatgtgggatcctggaagcagttctgacgtcggcacacatt
gtcttaggactaccgcatgagttgttgaaggaggttactgtagatgacctatttccggag
gggcttggcgagcaggagaatgggattcgaggtaggagaaaaatgcatcaactcagctac
tacctcgaagaattcggttcggacctaatggaaatcgctgctgaaatgggtgacaaagga
gcaatgctgtacatggcacatgcctatgagactggacagagactgggaccgaatcgtagt
acggattataagaaatccattgattggtaccagcgtgtcgtcggcttccaggacgacgaa
caacccgaacaagactccacaaattctggaaagtctgcgttctcctcgttctctccactc
tctcgtcacgagattctggctaaaatggctgaaatgtacaaagaaggaggatacgggctg
aatcgagacttcgaacgagcctattgcctcttcaacgaggctgccgaggcggcgatggag
gcgatgaatgggaaattggccaataaatattatgagaaggccgaaatgtgtggggaataa

DBGET integrated database retrieval system