KEGG   Caenorhabditis briggsae: CBG21144Help
Entry
CBG21144          CDS       T01054                                 

Definition
Hypothetical protein CBG21144
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CBG21144
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CBG21144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
III
AA seq 470 aa AA seqDB search
MTDDVDAHIHEKFELQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFRE
VMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQ
LFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSSLEDYPEGQKMPDLTEY
VATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTITKP
SRQDIASIGSHYAASVLEKMPQRPRKPLDLIITQSQTAAIDMVQRLLVFAPQKRLTVEQC
LVHPYVVQFHNPSEEPTLHYEVYPPLPDHVQLGIDDYRDRLYEMIDEQKASFKRIQHDKI
RPFSPKDKSRAPIAQAECSDTDYDTARSLQKSTSMDKNTSSSHDSSAGTLRERAQSAESR
TSKGSNGDMRNGNGSAISNGIKQRRRSIERSRLFANIKPSKILHPHKLIS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgacgtggatgcacatatccatgagaaattcgaattacagaaacgactgggc
aaaggtgcctatggaatcgtgtggaaagcctatgacaaacggtccagggagacggttgcg
ttgaaaaagatcttcgacgcgttccgaaacccaacagattcacaacggacgtttcgagaa
gtgatgtttctgcaagagtttggaaagcatccaaatgtcattaaactgtacaatatattc
cgagcggataatgatagggacatctatctggcattcgagttcatggaagcggatcttcac
aacgtcatcaagaagggctcgattctgaaggacgtccataaacagtatatcatgtgtcag
ctattccgagccatacggtttttacactcgggaaatgtgcttcatagggacctgaagcct
tcgaatgttcttctcgatgcggattgtcgtgtgaaattggccgatttcggattagctagg
agcttgtcatcgctcgaagactatccggaagggcaaaaaatgccggatcttaccgagtac
gtggctacgagatggtaccgtagtccggaaatcctgttggctgctaaaagatacaccaaa
ggagtggatatgtggagtttgggatgtattctcgcggagatgttgattggccgcgctctg
ttccctggctcctcaacgatcaatcaaatcgaacggatcatgaacacgatcacaaagccg
tcaagacaagatatcgcaagtattggaagtcactacgcagcgagtgttctcgagaaaatg
ccccaacgtcccagaaaaccgttggatttgattattacgcagagtcaaacggctgcaatt
gatatggtgcagagactactggtgtttgccccccagaagcgtctaaccgtcgagcagtgt
cttgtacacccatacgtcgttcaattccacaatccttccgaggaaccgacactccattat
gaagtctatccaccactaccggatcatgtgcaattgggaatcgatgattatcgggatcga
ttgtacgagatgattgacgagcagaaagcgagtttcaagcgcattcaacatgataagatt
cgaccgttctccccaaaggacaaatcacgtgcgccaattgctcaggccgagtgtagtgat
actgattacgatacggcgagaagtctacaaaagtcgacgagtatggacaagaacacgagt
agctcgcatgatagtagtgctggcacgttgagagaacgcgcacaatccgctgaaagtcga
acatcaaaaggaagtaatggagatatgaggaatgggaatggttcagcgatttcaaatgga
atcaagcagcgacgtcgatcaattgagagatcgagactttttgcgaatataaaaccatca
aaaattcttcatccacacaaattgatctca

DBGET integrated database retrieval system