KEGG   Caenorhabditis briggsae: CBG21247Help
Entry
CBG21247          CDS       T01054                                 

Gene name
Cbr-mpk-1
Definition
C. briggsae CBR-MPK-1 protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG21247 (Cbr-mpk-1)
   04012 ErbB signaling pathway
    CBG21247 (Cbr-mpk-1)
   04350 TGF-beta signaling pathway
    CBG21247 (Cbr-mpk-1)
   04068 FoxO signaling pathway
    CBG21247 (Cbr-mpk-1)
   04150 mTOR signaling pathway
    CBG21247 (Cbr-mpk-1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CBG21247 (Cbr-mpk-1)
Enzymes [BR:cbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CBG21247 (Cbr-mpk-1)
Protein kinases [BR:cbr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CBG21247 (Cbr-mpk-1)
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG21247 (Cbr-mpk-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 374 aa AA seqDB search
MADGDAVISTVNNVEEVHGQLFEVAPRYVNLSYIGEGAYGMVASALDTITKDRVAIKKIS
PFEHQTFCQRTLREIKILNRFKHENIINIQEIIRSETVDSLKDIYIVQCLMETDLYKLLK
TQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVTDPQ
TDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDVWSVGCILAEMLNNRPLFPGKHYLDQL
NLILAVVGSPSNEDLQCIINDKARSYLISLPHKPKQPWSRLYPGADPRALDLLDKMLTFN
PHNRIDIEQALAHPYLEQYYDPGDEPVCEEPFTLEMEFDDLPKERLKELIWEEAEAHHKR
VMAEQARNAGAPNV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggtgacgcggtgatttcgactgtgaacaatgttgaggaggtgcacggacag
cttttcgaggtcgctccacgctatgtcaatttgtcgtacattggagagggcgcctatgga
atggtggcatccgcactcgatacgatcaccaaggaccgcgtcgcgataaagaagatctcg
ccgttcgagcatcagacgttctgccaacgcacgcttcgagagatcaagattctcaatcgt
ttcaagcacgagaatatcatcaacatccaggagatcattcgctcggagactgtcgactcg
ctcaaagacatctacatagtgcaatgcctgatggaaacggatctctacaaactgctgaaa
acgcagaagctctccaacgaccacgtctgctacttcctctatcaaatcctgcgcggactc
aagtacattcactcggccaacgtgctccatcgcgatctgaaaccatcgaatctgcttctg
aacaccacgtgcgacctgaagatctgcgatttcggtctggcaagggtcaccgatccgcag
acagatcacactggtttcctgacggagtacgtggcgactcgctggtacagagcaccggag
atcatgctcaactccaagggatacacgaaatcgatcgacgtctggtcggtgggatgcatc
ctcgccgagatgctcaacaatcggccgctcttcccaggaaaacactacctggatcagtta
aatctgatccttgcggtagttggatcaccgtcgaacgaagacttgcagtgcataatcaac
gacaaggctcgctcgtacctgatctccctgccccacaagccgaaacaaccgtggtcccgt
ctctacccgggagccgatcctagagccctcgatttgctcgacaagatgctcacattcaac
ccacacaaccgcatcgacatcgagcaagcgctggcccacccgtacctcgagcagtactac
gatccaggagacgagccggtgtgcgaggagccgttcactctggaaatggaatttgacgat
ttgccaaaggagcggctgaaggagctgatttgggaggaggccgaggcgcatcacaagcgg
gtgatggctgagcaggcacggaatgcaggagctccgaacgtctaa

DBGET integrated database retrieval system