KEGG   Caenorhabditis briggsae: CBG21644Help
Entry
CBG21644          CDS       T01054                                 

Gene name
Cbr-daf-15
Definition
C. briggsae CBR-DAF-15 protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cbr  Caenorhabditis briggsae
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CBG21644 (Cbr-daf-15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 1800 aa AA seqDB search
MEEERSLSPFSSFAERLTVNMWHAQRNVERVTLYLQEPRHVENIAGSMEDEWDYIEECSS
RRKGNDRLRTASVAIIMCLHLGVDPPEAPSRKDAPARLLSWVDPYKCGAHKAAMEVGLST
QRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPRPTDNGEI
WVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILQNYRRFGDDQKISWQSRFDRW
QEEQRNLPPISSKMNDADAAEALGFPEKYPKYNDCIHLAACSAGQYLPMSNPHLPADLFT
SCLTTPIRTSLAFHLSHSERRDEYPENILDMIPGNLAERRTVLGELNWIFTAITDTIAFT
SIDRDCFQRLFRQDLLLATLFRSFLLAQRVLSKFDVQPVSQPALKDTSRHDLWRCWDQTM
DMVLDYCRELIYVKDTERALFCGRDVINRSSVFPFLVLIDFEHVLTYNETHQYNTFFTEQ
LQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGI
FPYVLKLLQSNINDLKISLAFIWAKILAVDPSCQIELFNECIDESASTQAAAQQAAQQPP
PQESVSLKQSSMFVNHPPPPQLQMDKRALQINTQTGGRFQNNQNQALDMQLQYAQQHAQQ
RQNGGQQSPNPQRQQQQGQQQQQQNNQQQNGQQKQNNQQSQQQQQQQQQGTTTQAQEKKT
MLRFQYFLQLLADPDIKPKQKTVAAFVLAQLTSNNFKLAQKELTSKGYMAICTELMVDDT
ARSVKLLKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDDSAEVRAAAVFALGSL
LRNSSRSNEHASAVEENLADELCMQCVFDSSVLVREELIVALQWFVFDFEKRFIKFLLDL
SNQVKFKVPRRRNSDSITDEDDINEEGLDIASEMPSSRRPHAKTPPVNEFTQTSFIRKKA
STSVFNTAVEESFTYDLGGNLILMGHENENYVERESGDVEYRERARLQIKHLEAKTFNEA
VARTWLSLLRLSLDPIERVARMAQKIVHRVEAGIPEMIANIDNTMAVLNRKMIARKTSRA
TVEMPRRPVGPNEEVSNLADRIKRNLEVERETGVGSQGIDFTLMNAQKDKEQRKGKSQLN
KLQDESKVKFQVGSPADPHQQHSRNPMSPGSSFTDDTQSSELFSKDEESEEEENGVAVAR
SATEERDVATTASGKTVKGVFKPYFPGKSDFIDAATMEFTPRRSKAVPGDFALKEESKTL
RAVIENPIVTTHFVAWCSKVFVEPILHVITLDEEKALEMEHEDEDEFMPDAYRDKIKEIQ
KQDKEKSDQKRARDKKEGKKEKSQEDVVLTTTTISDWAIHAMEGMLQSAEVEGRDFDNNR
YDECLWRVKLPHQARSVVTSKLRRCMYATDGQWMTIIRQDHNPKLFRRFELTDNNPFCPS
FISQLILINDMSREMVIACSSNGVVRIWDPCFLAWCDDYEKPAELVSASFPLESQMKLSD
DTNRCLFDWNQQNGKLLCTGSRSVRIWDAHCEKVCQDVMYSPGSKQQGGLGVKLDKNTLP
TAMSGNLDEEGNMVAVGYGDGRVDYFDMRMANPKAAKCSLAPVNGHTNFESKPPGIMHLR
VNRTGYATELFAGSQDGSIYKLQLRMFKEATPSIVTPWTPGEHSHMWVHDDSRILASASR
QHVAIYDVAKNKKISYFQPPTAADVVRTPHQALPKHQRKLSSIFSTQSDSRMTEINSRAV
QDRRKQSENPPSVISLTMHQMRLLTVVGYSDKTVAVFGSKTPGLTGTYDTTQDANVEGKF
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaacgaagtttatcgccgttctcttcgtttgcagagcgattgacagtcaac
atgtggcatgctcagagaaatgtagaaagagtgacattgtatttacaagagccgcgacat
gttgagaatatcgccggaagcatggaggacgagtgggattatatcgaagagtgctcaagc
cgtcgaaaaggaaatgatcgtctgcgcacggcttctgtcgctatcattatgtgtcttcat
ttgggagtggatccaccggaagcgccgtctcgtaaagacgctccagcacgtcttctctcg
tgggtcgatccgtacaagtgtggagctcacaaggctgcgatggaagtcggtctgagcaca
cagagggcgtacgagaagtggcagccgaaatcaaaaacccgctacaaaatctgcacggat
cctccgatcgacgacgtccgcaaagtggccaccaacctccgtcgtataagtggaaacgat
cgagttctgttccattacaacggtcacggtgtgccacgacccacagataatggagagatt
tgggtgttcaataaaagcttcacccaatacatccctctgtcgatattcgatctccaagga
tggttggactatccgacaatctatatttgggagacacactcagcagagacaattcttcag
aattatcgacgatttggtgatgatcagaagatctcttggcaaagcagattcgatcgatgg
caagaggaacaacgaaatcttccaccgatttcctcgaaaatgaatgatgcagacgcagcg
gaagcgttgggattcccagagaaatatccgaaatataatgattgcattcacttggcagct
tgtagtgctggtcaatacctccccatgtcgaatcctcatcttcctgcagatctattcact
tcttgcctcactacaccgattcgaacgtctctggcattccatctgagccattctgaacgt
cgagacgagtatccagagaatattctggatatgatcccaggaaatcttgcggagagacga
acggtccttggagagctcaattggatattcacggccatcacagacacaatcgctttcacc
tcgatagatcgagattgctttcagaggctgttccgacaggatcttcttctggcgacactc
ttcagaagtttcctactagctcaacgagtcttatcaaagtttgatgttcaaccagtatct
caacctgctctcaaagacacttctcgacacgatctatggaggtgttgggatcaaacaatg
gatatggtgctggattactgtagggagctgatctatgtgaaggataccgagagagctctg
ttctgtggaagagatgtcatcaatagaagcagtgtattcccatttttggtcctcattgac
ttcgaacacgtgctcacctacaacgaaacccaccaatacaacacattcttcactgagcag
cttcaagcttttgagttatggctggattatggagtggacgaaggaacaccccctcttcag
cttccaatggttcttcaagtgctgttgagtcaggcacatcgagttcgtgctttgagattg
ctagctagattcttagactttggaaggtgggcaattggatactccctggctgttggaatc
ttcccatatgttctcaaactgctccaaagtaatattaacgatctaaaaatctctttggca
tttatttgggcaaaaatcctggcagtcgatccatcctgccaaattgaactgttcaatgag
tgtattgatgaatctgcgagcacccaggcagcggctcaacaagctgctcaacagccacca
ccccaggagtctgtctctctgaagcagtcgtccatgttcgtcaatcatcccccaccgcca
caacttcagatggataagcgtgctcttcagatcaacacgcagaccggtggaagattccag
aacaatcagaaccaggcgttggatatgcaactacagtatgctcagcaacatgctcagcag
agacaaaatggaggtcaacagtcacctaatccacagcggcagcagcagcaaggccaacag
caacagcagcagaacaatcagcaacagaatggccagcaaaaacagaataatcagcagtca
cagcaacaacaacagcagcagcagcaaggcaccacgacacaggctcaagagaagaagacg
atgctgcgattccagtacttcctccagctactcgccgacccggatatcaaacccaaacag
aaaacagtagcggcgttcgttctagctcaattgacatccaacaacttcaaactggcacaa
aaagagctcactagcaaaggatacatggcaatctgtaccgagttgatggttgacgacact
gcgagatctgtaaaattgctcaagctgtggattctaattggtcttggacgtctctggtcg
gattatgatgtagctagatggcagggaatccgtctgatggctcatgataaaatgattctg
gagctgagtgatgattcggcggaagtcagagctgctgcggtttttgctctgggaagcttg
ctccggaattcgtcgagatccaatgaacatgcgtctgcagtagaggagaatctcgctgat
gaattgtgtatgcagtgcgtctttgatagttcggtactggtcagagaggagctgatcgtt
gctctccagtggttcgtctttgatttcgagaagagatttattaaattcctgctggatctg
tcgaatcaagtgaagtttaaagttccgagaagacgaaattctgattcgataaccgatgaa
gatgatatcaacgaagaagggctagatatcgcttctgagatgccgtccagccgacgtcca
cacgccaaaacccccccagtcaacgagttcactcaaacatcgttcattcgaaagaaggcg
tcgacgagtgtattcaacacggcggttgaagaatcattcacctatgacctaggagggaat
ctgattttgatgggacacgagaacgagaactacgtagagcgagaatctggagacgttgag
tatcgagaacgcgcacgtcttcaaatcaaacatctcgaagccaagacgttcaatgaagcc
gtcgcgagaacgtggctatcattgctccgactatctttggatccgattgaaagagtcgct
cgaatggcacaaaaaatagtgcatcgtgttgaagctggaataccggagatgatagccaac
attgataacacaatggcagtcctgaatcgcaagatgatcgctcgtaaaacgtcccgagcc
actgtcgaaatgccacgtcgacccgtcggaccaaacgaggaggtcagcaatctagcggat
agaatcaaacgaaatctagaagttgaacgagaaaccggtgttggctcgcagggcattgat
ttcacactgatgaatgcgcagaaagataaggagcagcggaagggaaagagtcagttgaat
aagttgcaggacgagtcgaaagtcaagtttcaagttggaagtcccgcggatccccatcag
cagcattctagaaatccaatgtcacctggtagctcattcactgatgacacccagagcagc
gagctattctcgaaggatgaggaaagcgaagaagaggagaacggtgtagccgtcgcgaga
tcggctacagaagagcgtgacgtggcaacgacggcgtctggaaagactgtcaagggtgta
ttcaaaccctattttccaggaaaatccgacttcattgacgccgctaccatggaattcacc
ccaagacgatccaaggctgtccccggagacttcgctctgaaagaggagtcaaaaaccctt
cgagccgttatagaaaacccaattgtgacgactcacttcgtcgcatggtgcagtaaagtg
ttcgtcgaaccgattctccacgtcattactcttgacgaggagaaggcgttggaaatggag
cacgaggatgaggatgaattcatgcctgacgcgtatagagacaagattaaagagatacag
aaacaggataaggagaagagtgatcagaaaagagcaagggataaaaaggaggggaaaaag
gagaagagtcaagaagacgtggttctgacgacgacgacgattagtgattgggcgattcat
gcgatggaaggaatgcttcaaagtgctgaagtggagggaagagattttgataacaataga
tacgacgaatgcctctggagagtcaaattgccacatcaagcacgatcagtggttacttcg
aagttgagaagatgtatgtacgctactgatggtcaatggatgacaatcattcgccaggat
cacaatccaaaactgttccgtcgcttcgaactaaccgacaacaatccattctgcccatcc
tttatttctcaactgattcttatcaatgatatgtcgagggaaatggtgatcgcttgtagc
tcgaacggtgtcgtccgcatttgggatccttgttttttggcgtggtgtgatgactatgag
aaaccggcggagttggtgtcggcgtcgttcccactggaatcgcaaatgaaattgagtgac
gatacgaatcgatgtctttttgactggaaccaacaaaacggaaaactcctctgcaccgga
agtcgaagtgtccgtatttgggatgcccactgcgagaaagtgtgtcaagacgtaatgtac
tctccaggcagcaaacaacaaggaggtctcggcgtgaaactcgacaagaacactcttcca
acagccatgtctggaaatctagacgaagagggaaacatggtggcagtcgggtatggagac
ggtcgtgtcgactatttcgatatgagaatggcgaatccaaaagcggcgaaatgcagttta
gctccagtcaacggtcacacgaatttcgaatctaaaccaccgggaatcatgcatttgaga
gtgaatcgaactggatatgcgactgagttgtttgctggaagtcaggatggatcaatttac
aagcttcagcttcgaatgttcaaagaagccacgccatctattgtcaccccatggacaccc
ggagagcactcgcacatgtgggtccacgatgactcgagaatcctcgcatcagcgtcaaga
cagcacgtggctatttatgatgtggcgaaaaacaaaaagatctcgtacttccaaccaccg
accgccgccgacgtggttcgtacaccacaccaagcactaccgaaacatcagaggaagctt
tcatcgattttttcgacgcaatcagattcgaggatgactgaaataaattcaagggcggta
caagataggcggaaacaatcggaaaatcctccaagtgttatttcgttgacaatgcatcaa
atgagactgcttaccgtagtcggctacagtgacaaaaccgtcgccgtttttggttccaaa
actccaggactcacaggaacctacgatacgacacaagacgctaatgttgagggaaaattc
taa

DBGET integrated database retrieval system