KEGG   Caenorhabditis briggsae: CBG22127Help
Entry
CBG22127          CDS       T01054                                 

Gene name
Cbr-hex-4
Definition
C. briggsae CBR-HEX-4 protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG22127 (Cbr-hex-4)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CBG22127 (Cbr-hex-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
I
AA seq 371 aa AA seqDB search
LIVHIDLKGAPPRVEYLIDFFKLLSKNHVDGVVMEYEDMFPYSGDLEDVRRDSGAYSEDD
IRRITMEAAALNLEIIPLIQTFGHLEFLLKRPAFRTLSEDFIDINTICISDDRSIDIIHQ
MILQIRRLHPNSTRIHIGSDEAYHVAEDVRCHQKMSNEKIGKSELKMRHIAKIGKFAREI
AHFKTVFAWNDMFDKEAETDTSQRVFLRGFQMFLRSFMWPALIKAGFLAHYQKCFFSKII
SADGARQQFSNISRYLENQKSYTKLMDLHPKAAGKLECDQETFLRGVLSEWTIRGCEFPG
ADVFEIIMHEWKRQVDRRLLGRADLSPDQKSPTEVLSNLRTALKPILFDADIDEIYHQYL
NDFHSIHSRTT
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttaatcgtgcatatcgatttgaaaggagcgccgcctcgagtcgaatatctcattgatttc
ttcaaattattgtcaaaaaaccacgtggatggtgtggtgatggaatacgaggatatgttt
ccatattctggagatttagaagacgtcaggagggattctggagcatattcagaagatgac
atcagaagaatcacaatggaagcggctgcgttgaatttggagattattccgttgattcag
acttttggacacttggaatttttattaaaacgccccgcattccgcactctatccgaagac
ttcatcgacatcaacacaatttgtatttccgacgatcgatcaatcgatatcatccatcaa
atgattcttcaaattcgacgtcttcatccgaattccactcgcattcatatcggttcagat
gaagcgtaccacgtggcagaagacgtcagatgtcatcagaagatgagcaatgagaaaatt
ggaaaatctgagctaaaaatgagacatattgcgaaaattgggaaattcgctagagaaatt
gctcattttaagacggttttcgcctggaacgatatgtttgacaaggaggcggagacggat
acttcccagagggtctttttgagaggattccaaatgtttttgaggagttttatgtggcca
gcgcttataaaggcaggatttctggctcactatcagaaatgttttttttccaaaatcata
agtgccgatggagcgcgacaacagttttctaacatctcccgctacttggaaaatcagaaa
tcctacacaaaattgatggatttgcacccaaaagcagctggaaaactggaatgtgatcag
gagacgtttttgagaggtgtcctctcggaatggaccataagaggatgcgaatttccgggg
gcggatgtttttgagattataatgcacgaatggaaacggcaggtggatcgtcggctactg
ggtcgagccgacctctcaccggaccaaaaatcacccacagaagtgctgagcaatctgaga
acagctctaaaaccaatcctcttcgacgcggatatcgatgaaatttatcaccaatacttg
aatgatttccattccattcattcgagaacaacc

DBGET integrated database retrieval system