KEGG   Caenorhabditis briggsae: CBG23105Help
Entry
CBG23105          CDS       T01054                                 

Gene name
Cbr-math-33
Definition
C. briggsae CBR-MATH-33 protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    CBG23105 (Cbr-math-33)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG23105 (Cbr-math-33)
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CBG23105 (Cbr-math-33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 1129 aa AA seqDB search
MCSPDPEDMHILTNDIPSFDKSLDPYGPEGHLALDIERFSSFMNKPDSRIMSKPVIVRGI
PWRILAICRHQQNNRQVATSRSRNNYNFGFFLQCNNDDLLQKRGMWRCYGQATLEVLNAN
GPPIQKKIHHSFHNTEVDWGFSNYDQYDTLTSPKDGYVIDDVIRLRCRFTADVPTGANYM
WDSKKHTGCIGLRNQGATCYMNSILQSFYFTTGFRRAVYNMEVGTEPNESNIVLAMQRVF
YELQMSSEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLF
RGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFDAYTTPETLDDDNKYDAGDH
GLQRAEKGVKFVELPPVLHVQLMRFQYCGVEQKINERFSFPEKMNLSNCCELGPMLNEED
CVYSLHAVLVHSGEFHGGHYVTYINVNLHESAVDPTATAKWCKFDDDVVSRTTTDDAIVS
NFGGEKAMNSSAYMLVYVRDNAIDQVLAPIPDTQIPQSVSRTFEMERMHRNREKKKQEEE
QMCMSITLVTPDILATNHSFDLIEPVTITDVLPHETVYKHMVTAELYQFVQEKLFEKSTL
PKVDMFDSDDETRMKRKEILRRLKTKKFGFRLWRMTDSYTVDKPQKMASRLRPSDFIEYS
IDTRLDHTLSHDTETIYVEHSQFLQPLNEYLPTRDILFFLKYYDAITDKFTIIGHVTLDS
HKRLNLYRMTFCDLLGLPKDTELKYYIEHAPNHVEQIDDPNRSTISRLVDDQDGAIVIVE
KADPTAKKDAKTKMIELYNDVEFEFSQQFYSKMPNEEPFELFTKRFCLEQKLTDVTEFIG
SELNVDPRNVMLWTRVSGSRFEPNFDDYAVTGIQCKYLTLRTLHDPRQHKKYSVSYAIFP
FPVNEVHTTRMFVRLYRQMPNGNVEELNLFPPKDGTVTDLIAEAKRYYPSVEGGSGKFRL
LQIGTSPLNNQRVFQIYNENTAIVDLDQRPVYKQQAQHTLNCRIEEIPHDELDVAQGEFF
CPVVHYDREPTKLFGVSFVIKIRNGELMTDVRDRLRRKLPDVSDAEFAKYKFALLSRDKL
CRNIEFNAGEKVNLMDMANQTTGVPQVYIGLDHKSPSQHSNEAAIRILN
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgccggatcccgaagatatgcatatcttaaccaatgatatcccctcatttgat
aaaagcctcgatccctatggaccagaaggccatttggccctggatatcgagagattttcc
tcgtttatgaataaaccagacagtcgaattatgtccaaaccagtgatcgttcgaggaatc
ccttggcgcatcttggctatttgcagacaccaacagaacaaccgccaggttgcgacttca
cgatctcgtaacaactacaatttcgggttcttcctacagtgcaacaacgatgatctactg
cagaaacgaggaatgtggaggtgctatggacaagctactcttgaagtgctgaacgccaac
ggaccgccaatacagaagaaaattcatcactcgtttcacaataccgaagttgactgggga
ttttcaaattatgatcagtatgatacattaacgagccctaaagacggatacgttattgat
gatgtgatcagattgcggtgccgtttcactgccgatgttccaactggagctaattacatg
tgggatagcaaaaaacacaccgggtgtattggattgcgaaaccaaggagctacttgttat
atgaattcgatattgcaatcgttctacttcacgactggtttccgccgcgctgtatataat
atggaagttggtacagaaccgaatgaaagcaacattgtgctcgccatgcaaagagttttc
tatgaacttcaaatgtctagtgaagcagtcgaaacaaatagtttgacacgagcattcggt
tgggacaagcttgacgccttcaatcagcacgatgttcaagagttttgtcgagttctcctc
gataacctggaaacaaaaatgaaaggaacatctgaagaaaaatcgatccccaatctattc
cgtggaaatatgaaatcatatatcaagtgccttgatgtagattatgagagctcacgaact
gagtctttctatgatgtacagctcaacgttttgggaatggatagtttagaacgtgctttc
gacgcgtataccacacctgaaacacttgatgatgataataaatatgatgctggagatcac
ggtctacaacgagctgagaaaggagtcaaatttgttgaattaccaccagtgctacatgtg
cagttgatgcgtttccaatattgtggtgtggagcaaaagatcaacgaacggttttcgttt
ccggagaaaatgaatctttcgaactgttgcgaacttggaccgatgctcaatgaggaggac
tgtgtttatagtctacatgccgtccttgtacacagtggggaattccacggcggacactac
gtcacctacataaatgtcaacctgcatgaatcggcagtcgatccaacggcaaccgcgaaa
tggtgcaagttcgatgacgacgtagtttcgagaacaacgacagacgacgccattgtcagt
aattttggaggtgaaaaggctatgaactcgtctgcttacatgctcgtctatgttcgagat
aatgctattgatcaggttttggctccgattcctgacacgcagattccgcaatccgtgtct
cgtacttttgaaatggaacgaatgcatcgtaatcgtgagaaaaagaaacaggaagaagaa
cagatgtgtatgagtattactcttgtaactccagacattctcgcgacaaatcactcgttt
gatctaattgaaccagttactatcaccgacgttctcccacatgagactgtatacaagcac
atggtgaccgcagaactctaccaattcgtgcaagagaagcttttcgaaaaaagcaccttg
ccaaaagttgacatgttcgattcggatgatgaaaccagaatgaagagaaaagagattcta
cgtcgtttgaagacgaaaaagtttggtttccgactatggaggatgactgactcatacaca
gtagacaaaccccagaaaatggcatcgagattgagaccaagtgattttatcgagtacagc
atcgatactcgcttggatcataccttgagccacgatactgagacaatctacgttgaacat
tctcagtttcttcagccactaaacgagtacttgccaacccgtgatatcttattctttttg
aagtactacgatgcaatcaccgacaaattcaccatcattggacacgtcactctggattct
cacaaaagattgaacttatatcgcatgacgttctgtgatctacttgggttgccgaaagac
accgaactgaagtattacattgagcacgcgccaaatcatgtcgaacaaatcgatgatcct
aatagaagcacaatcagcagacttgtggacgatcaggatggtgccatagtaattgtagag
aaagccgatccaactgcgaaaaaagacgctaaaacaaaaatgatcgagttgtacaatgat
gttgaatttgagttttctcaacagttctatagcaaaatgccaaatgaggaaccatttgag
ctattcactaaaagattctgcctcgaacaaaagttgactgacgtaacggaattcatcgga
tccgaattgaatgtcgaccccagaaatgtaatgttgtggactcgtgtctctggtagccgc
ttcgaaccgaacttcgacgattacgctgtcacggggatccagtgcaaatatttgacattg
agaacgctacatgatcctagacaacataaaaaatatagtgtctcatatgcgatcttcccg
ttcccagtcaatgaagtgcataccacacgtatgttcgtccgactttaccggcagatgccc
aacggaaatgtagaagaactgaatttgttcccgccaaaggatggaactgtgacagatctc
atcgcagaagccaaacgatattatccatctgtagaaggcggatccggaaagttcagactt
cttcaaatcggaacttcacctctcaacaaccaacgtgtctttcaaatctacaacgaaaat
acggcgattgttgatcttgatcaaagaccagtatataagcagcaggctcaacacacactt
aactgtcgtatcgaagaaattcctcacgatgagttggacgttgctcagggagagttcttc
tgtccagtggttcattacgatcgtgagccaacgaaacttttcggagtttcgttcgtcatc
aagattcgcaacggggaactgatgactgacgtgcgtgatcgtcttcgtagaaagctgccc
gatgtttcggatgctgagttcgcgaagtacaagttcgctttgttgagcagagacaagctt
tgtcgcaatattgaattcaatgccggcgagaaggtcaatctcatggacatggcaaatcag
accactggagttcctcaagtctacataggattggatcacaaatcaccatcccaacattct
aatgaagctgccatacgaattctgaactga

DBGET integrated database retrieval system