KEGG   Caenorhabditis briggsae: CBG23139Help
Entry
CBG23139          CDS       T01054                                 

Definition
Hypothetical protein CBG23139
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
cbr  Caenorhabditis briggsae
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CBG23139
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG23139
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CBG23139
   00604 Glycosphingolipid biosynthesis - ganglio series
    CBG23139
   00511 Other glycan degradation
    CBG23139
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG23139
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CBG23139
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBG23139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
V
AA seq 661 aa AA seqDB search
MNLWTTWLFITLNLLISTNGLVRTSYGNWNLERIGDGNTPSFLIDESKNQFLLDGLPFRY
ISGSIHYFRIPRERWEERLGKVRALGFNAIQYYIPWNAHELEEGNHDFSGILDFAEFSSM
AFHKYNLWTILRIGPYICGEWENGGLPAWLLNKNVTKQRSSDPVFTREVEKWFETLLPRV
KPLLRKNGGPVLMLQIENEYGSYGVCDKQYLRFLRDLTRAHVGDDVLLFTTDGASEKLLK
CGTVEGVFPTVDFGPTDNKKDIESYFQIQRKYAPNAPFVNSEYYPGWLVLWGQKRQDLPS
PQTIINGAQTMYSLGASMNFYMIHGGTNFGFWNGAETEAPCISSYDYDAPISEAGDVTAK
YLEIRKWIKGLTDWTTPPLDVPGNSPKARYGKIKMRLAHSNGNSNGNGFMGDFTDPGDCV
DSERPLSFEKMKHFLGLIAYQSKINSCGNLTIPSFGDFVYVYLNGKYIDTLTRRYYNLTR
SSVILGGCRNDGEDRLFLLVENQGRQTFETINDRKGILSEVYLNGEAVHFWTQCGIKLPI
QSEESQDYNRKAMKKILRNKLSKDNQKQGVFVGVLEVEAAADTWLDTTGWGKGIAIVNGR
NLGRYWPTEGPQMTLYIPAEYLKVGDNLVMMVELEGATDACTSTTACVADFIDHPIFHFG
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaacctatggacaacgtggcttttcattactctgaatctattgatttctactaatggt
ttagtgaggacgagctatggaaactggaatttggagaggatcggagatggaaacacccca
tcattcttgatcgatgaatcgaaaaatcaatttcttctcgatggccttccgttccgttac
atttccggatccattcactacttccgaattccgcgggagagatgggaagaacggctcgga
aaagttcgtgctcttggattcaacgcaattcaatattacatcccatggaacgctcatgaa
ctggaagaagggaatcatgacttttctggaatcctggatttcgccgaattctcatccatg
gcatttcataagtacaacctgtggactattttaagaattggtccttacatctgcggagaa
tgggaaaacggaggtctcccagcatggcttctgaataagaatgtcaccaaacaaaggagt
agtgatcctgtattcacccgcgaagtcgagaaatggttcgaaaccttactgccacgtgtc
aaacctcttcttcgaaagaacggaggtcctgttctgatgctacaaattgagaacgagtac
ggtagttatggcgtctgtgacaaacagtatctccgattcttgagagatctgaccagagct
catgttggagatgacgtgcttttgttcactaccgatggagcttctgaaaaactcttgaaa
tgtggaactgttgagggtgtgtttcccactgttgattttgggccaacggataacaaaaaa
gacatcgaatcgtattttcaaattcaacgaaaatatgctccaaatgcgccattcgtgaat
tcggaatattatccaggttggctggtactttggggacaaaagagacaagatctcccatct
ccacaaacaattatcaatggtgctcaaacaatgtactccctcggagccagcatgaatttt
tatatgattcatggaggaacaaattttggattttggaatggagctgaaactgaagcacct
tgtatttcttcctatgattatgatgctccaattagtgaggcaggagatgtgactgcaaaa
tatttagaaatcagaaaatggatcaaaggattgacggattggacaactccaccactggat
gtacccggaaattctccaaaagcaagatatgggaagatcaaaatgagattggcccactca
aatgggaattctaatgggaatggattcatgggagacttcaccgatccaggagattgtgtt
gattctgaaagaccactcagttttgagaaaatgaaacattttctaggattaattgcttat
caatcaaaaatcaattcctgtggaaatctcacaattccatcgtttggtgattttgtttat
gtgtatcttaatggaaaatatattgacactctcactcgccgatattacaacttgacgcgc
agttcggtgatcctcggagggtgcagaaatgatggagaggatcgactatttttgttggta
gaaaaccaaggcagacaaactttcgaaacaatcaatgatagaaaaggaatcctctctgaa
gtgtatttgaatggggaagctgttcatttttggacgcagtgtggaatcaaacttccaatt
caatcagaagaaagtcaggactacaaccgaaaagccatgaagaaaattctaagaaataag
ttatccaaagataatcaaaagcaaggtgtctttgtcggtgttctcgaagtggaagcagca
gctgacacgtggttggatactactggatggggaaagggtattgcaattgtgaacggaagg
aatcttggaagatactggccaacagaaggtccacaaatgactttgtacatacctgcggag
tatttgaaagttggagataatctggtgatgatggtagaattggaaggtgctacagatgct
tgtacaagcacaactgcctgtgttgccgatttcattgatcacccaattttccattttggc
aagtaa

DBGET integrated database retrieval system