KEGG   Caenorhabditis briggsae: CBG23183Help
Entry
CBG23183          CDS       T01054                                 

Gene name
Cbr-cnb-1
Definition
C. briggsae CBR-CNB-1 protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:cbr04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cbr04310]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:cbr04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 171 aa AA seqDB search
MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVID
IFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMV
GNNLKDSQLQQIVDKTILFHDKDGDGKISFQEFCDVVEHTEVHKKMVLENI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgacgcctcacttccgatggagatgtgcagcaacttcgatgcctacgagttg
cgtcgtctcacccgtcgcttcaagaaacttgacgtcgacggatcgggatcgttgtccgtt
gaggagttcatgtcgttgcctgagttgcaacagaacccattggttcaaagagtcatcgat
attttcgatgaggatggtaacggagaagtcgacttccgagagttcatccaaggaatctcg
cagttcagtgtgaaaggtgacaagaacacgaagctcaagttcgctttccgcatctatgac
atggatcgtgatggattcatctcaaacggagagctcttccaggtgctcaaaatgatggta
ggaaacaacttgaaggactcgcaactccagcaaatcgtcgacaaaacgattctcttccac
gacaaggacggagatggcaagatctcgttccaggagttctgtgatgttgttgagcacacc
gaagtgcacaagaagatggtcctcgagaacatctaa

DBGET integrated database retrieval system