KEGG   Caenorhabditis briggsae: CBG23183Help
Entry
CBG23183          CDS       T01054                                 

Gene name
Cbr-cnb-1
Definition
C. briggsae CBR-CNB-1 protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cbr  Caenorhabditis briggsae
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    CBG23183 (Cbr-cnb-1)
   04310 Wnt signaling pathway
    CBG23183 (Cbr-cnb-1)
   04020 Calcium signaling pathway
    CBG23183 (Cbr-cnb-1)
Protein phosphatases and associated proteins [BR:cbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CBG23183 (Cbr-cnb-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 171 aa AA seqDB search
MGADASLPMEMCSNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVID
IFDEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMV
GNNLKDSQLQQIVDKTILFHDKDGDGKISFQEFCDVVEHTEVHKKMVLENI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgacgcctcacttccgatggagatgtgcagcaacttcgatgcctacgagttg
cgtcgtctcacccgtcgcttcaagaaacttgacgtcgacggatcgggatcgttgtccgtt
gaggagttcatgtcgttgcctgagttgcaacagaacccattggttcaaagagtcatcgat
attttcgatgaggatggtaacggagaagtcgacttccgagagttcatccaaggaatctcg
cagttcagtgtgaaaggtgacaagaacacgaagctcaagttcgctttccgcatctatgac
atggatcgtgatggattcatctcaaacggagagctcttccaggtgctcaaaatgatggta
ggaaacaacttgaaggactcgcaactccagcaaatcgtcgacaaaacgattctcttccac
gacaaggacggagatggcaagatctcgttccaggagttctgtgatgttgttgagcacacc
gaagtgcacaagaagatggtcctcgagaacatctaa

DBGET integrated database retrieval system