KEGG   Caenorhabditis briggsae: CBG23238Help
Entry
CBG23238          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG23238
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00010  Glycolysis / Gluconeogenesis
cbr00071  Fatty acid degradation
cbr00350  Tyrosine metabolism
cbr00830  Retinol metabolism
cbr00980  Metabolism of xenobiotics by cytochrome P450
cbr00982  Drug metabolism - cytochrome P450
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG23238
  Lipid metabolism
   00071 Fatty acid degradation
    CBG23238
  Amino acid metabolism
   00350 Tyrosine metabolism
    CBG23238
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG23238
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG23238
   00982 Drug metabolism - cytochrome P450
    CBG23238
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CBG23238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Epimerase adh_short 2-Hacid_dh_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 8578544
NCBI-ProteinID: XP_002636549
WormBase: CBG23238
UniProt: A8Y4E0
Position
V
AA seq 294 aa AA seqDB search
MSSTHRALIFDDFKGPLEVRQLPIPEPQDDEILVKINYSGICHSDLHAWNGDFDYATIHP
LIGGHEGAGVVVKTEYVTARAMDAIRIPKDLNLAAAAPVLCGGVTAYKALKETNVKPGQI
VAITGAGGGLGSFGIQYAGAMGMRVIAIDHSEKKDHCMNLGAEWFVDAFNTENLSDHIKN
ITNGGPHGIINFAAAKKPMEQAFEYIRKRGTIVLVGFPKDSKIMFDTTPLIFNAITVKGS
IIGSRLDTEEALEFVARGAVKVPLEMVKLEDVSKVYRKMEDGKINSRVVVDFSL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccactcatcgggcacttatttttgatgatttcaaaggaccactagaggttcga
caacttcctataccagaaccccaagacgatgagattctcgttaaaataaattattctgga
atctgccattcggatcttcatgcttggaatggcgattttgactacgcgacaattcatcca
ttgatcggaggtcatgaaggagcaggagtagttgtcaaaactgaatatgttactgctcga
gccatggatgccattagaataccaaaggatttgaatttggcagcagctgctccggttctt
tgtggaggagttaccgcatataaggcgctgaaagaaacaaatgtgaagccaggacaaatt
gtggcgattactggagctgggggagggctgggatcgtttggaattcaatatgcaggagcc
atgggaatgcgagttattgcaattgatcacagtgagaagaaggatcattgcatgaatctt
ggagccgagtggtttgtagatgcattcaacactgaaaatttatcagatcacataaagaat
attacgaacggaggaccccacggaattattaattttgctgcggcgaagaaaccaatggag
caagcattcgaatatatcagaaaaagaggaaccattgttttagttggatttccaaaagat
tcaaagattatgttcgatacaactccattgatattcaatgcaattactgtcaaaggttca
attattggatctcgtttggataccgaagaagcattggaatttgtggcccgtggagctgtg
aaagttccattggaaatggtcaaactagaagacgtctcaaaggtctacaggaagatggaa
gacggaaaaatcaattctcgtgttgttgttgatttctcattgtga

DBGET integrated database retrieval system