KEGG   Caenorhabditis briggsae: CBG23238Help
Entry
CBG23238          CDS       T01054                                 

Definition
Hypothetical protein CBG23238
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CBG23238
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG23238
  Lipid metabolism
   00071 Fatty acid degradation
    CBG23238
  Amino acid metabolism
   00350 Tyrosine metabolism
    CBG23238
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG23238
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG23238
   00982 Drug metabolism - cytochrome P450
    CBG23238
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CBG23238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
V
AA seq 294 aa AA seqDB search
MSSTHRALIFDDFKGPLEVRQLPIPEPQDDEILVKINYSGICHSDLHAWNGDFDYATIHP
LIGGHEGAGVVVKTEYVTARAMDAIRIPKDLNLAAAAPVLCGGVTAYKALKETNVKPGQI
VAITGAGGGLGSFGIQYAGAMGMRVIAIDHSEKKDHCMNLGAEWFVDAFNTENLSDHIKN
ITNGGPHGIINFAAAKKPMEQAFEYIRKRGTIVLVGFPKDSKIMFDTTPLIFNAITVKGS
IIGSRLDTEEALEFVARGAVKVPLEMVKLEDVSKVYRKMEDGKINSRVVVDFSL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccactcatcgggcacttatttttgatgatttcaaaggaccactagaggttcga
caacttcctataccagaaccccaagacgatgagattctcgttaaaataaattattctgga
atctgccattcggatcttcatgcttggaatggcgattttgactacgcgacaattcatcca
ttgatcggaggtcatgaaggagcaggagtagttgtcaaaactgaatatgttactgctcga
gccatggatgccattagaataccaaaggatttgaatttggcagcagctgctccggttctt
tgtggaggagttaccgcatataaggcgctgaaagaaacaaatgtgaagccaggacaaatt
gtggcgattactggagctgggggagggctgggatcgtttggaattcaatatgcaggagcc
atgggaatgcgagttattgcaattgatcacagtgagaagaaggatcattgcatgaatctt
ggagccgagtggtttgtagatgcattcaacactgaaaatttatcagatcacataaagaat
attacgaacggaggaccccacggaattattaattttgctgcggcgaagaaaccaatggag
caagcattcgaatatatcagaaaaagaggaaccattgttttagttggatttccaaaagat
tcaaagattatgttcgatacaactccattgatattcaatgcaattactgtcaaaggttca
attattggatctcgtttggataccgaagaagcattggaatttgtggcccgtggagctgtg
aaagttccattggaaatggtcaaactagaagacgtctcaaaggtctacaggaagatggaa
gacggaaaaatcaattctcgtgttgttgttgatttctcattgtga

DBGET integrated database retrieval system