KEGG   Caenorhabditis briggsae: CBG23239Help
Entry
CBG23239          CDS       T01054                                 

Gene name
Cbr-sodh-1
Definition
(RefSeq) C. briggsae CBR-SODH-1 protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00010  Glycolysis / Gluconeogenesis
cbr00071  Fatty acid degradation
cbr00350  Tyrosine metabolism
cbr00830  Retinol metabolism
cbr00980  Metabolism of xenobiotics by cytochrome P450
cbr00982  Drug metabolism - cytochrome P450
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBG23239 (Cbr-sodh-1)
  Lipid metabolism
   00071 Fatty acid degradation
    CBG23239 (Cbr-sodh-1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CBG23239 (Cbr-sodh-1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG23239 (Cbr-sodh-1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG23239 (Cbr-sodh-1)
   00982 Drug metabolism - cytochrome P450
    CBG23239 (Cbr-sodh-1)
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CBG23239 (Cbr-sodh-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C Epimerase adh_short AlaDh_PNT_C ACP_syn_III_C ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 8578545
NCBI-ProteinID: XP_002636550
WormBase: CBG23239
UniProt: A8Y4D9
Position
V
AA seq 349 aa AA seqDB search
MTVEIPTTQRALVFDTWNGPLEVRQVPVPSPADDEILVKIEYSGICHSDLHVWLGDLKGM
SVCPLVGGHEGAGSVVQIGKNVTGWQLGDKAGVKLMNFNCLNCEFCKKGHEPLCHHIQNY
GFDRSGTFQEYLTIRGVDAAKINKETNLAAAAPILCAGVTVYKALKESNVKPGQIIVLTG
AGGGLGSLAIQYANAMGMRVVAMDHSSKEAHCKNLGAEWFVDAFDTPDIVSHITKLTEGG
PHGVINFAVARKPMEQAVEYVRKRGTVVFVGLPKDSKVTFDTTPFIFNAITIKGSIVGSR
LDVDEAMEFVTRGIVKVPLELVKLEDVPAVYQRMIDGKITSRAVVDFSM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcgagatcccaaccacccaacgtgctcttgttttcgacacctggaatggacca
ctcgaagtgagacaggttccagttccatctccagccgacgatgagatcctcgtcaaaatt
gaatactctggaatctgccactctgatcttcacgtttggctcggagacttgaagggaatg
agtgtttgcccattggttggaggacacgaaggagctggaagcgttgttcaaattggaaag
aatgtcactggatggcaacttggagataaggctggagtcaagctcatgaacttcaactgc
cttaactgtgaattctgtaagaagggacacgagccgctctgccaccacatccaaaactac
ggattcgaccgttccggaaccttccaagaatacctcacaatccgtggagtcgatgctgcc
aagatcaacaaggagaccaacctcgccgccgctgctccaatcctctgcgccggagttaca
gtctacaaggctctcaaggagtcgaacgtaaagccgggacaaatcattgtactcactgga
gctggaggaggtcttggatctcttgccatccaatatgcgaatgctatgggaatgagagta
gtggctatggatcactccagcaaggaagctcattgcaaaaatctcggagctgagtggttc
gttgatgccttcgacactccagatattgtttctcacatcacaaaactcaccgaaggagga
ccacatggagttatcaactttgccgttgccagaaagccaatggagcaagctgttgaatat
gttagaaagcgtggaacagttgtgttcgtcggacttccaaaggactcaaaggtcactttc
gacaccaccccattcattttcaatgctattaccatcaagggatcgattgtcggatctcgt
cttgacgtcgatgaagccatggagttcgtgactcgtggaatcgtgaaggtaccattggaa
cttgtcaaactcgaggatgttccagctgtataccaaagaatgatcgatggaaagatcaca
tctcgtgccgtcgtcgatttctccatgtaa

DBGET integrated database retrieval system